bash-loadables-4.4-19.6.1 >  A a X p9| H91amzS'%cT`I ˍB0 oڑ JKڻξ+ԡeIEZaiHO mgYt)3![AqSI_ m5"8k⪘ H7FPy fŌA (%d,?u)gFJ"Ԝ44ɖ7_fਜ|[d屯.#Zѧ}@fp FP9Ei"cxApҔMb0c32f4245c47448e9b0fb95a416100b80cb1fc61e05ac68b683f9e45f59b30e7e6e9936aac3523a1f8e4f68b8d9c1f7162590cbaxa X p9|Fs`Xx"$-޺goD4+8Lמ] ^bJK!R>}٠Ozb%PJ:!7`ngg9xT,ѐpfN#^ko%6 D6i_iA WN w lIVռ,`b3Do%+?xaNMόu"ȻBV i (S[ƞk% w jd4%j`>p>`?Pd  3+ AOz * `   g   wv(869t6:6FqGqHrDIrXrYr\r]sX^t bt"ctduJeuOfuRluTuuhvuw xy>z LCbash-loadables4.419.6.1Loadable bash builtinsThis package contains the examples for the ready-to-dynamic-load builtins found in the source tar ball of the bash: basename Return non-directory portion of pathname. cut cut(1) replacement. dirname Return directory portion of pathname. finfo Print file info. getconf POSIX.2 getconf utility. head Copy first part of files. id POSIX.2 user identity. ln Make links. logname Print login name of current user. mkdir Make directories. pathchk Check pathnames for validity and portability. print Loadable ksh-93 style print builtin. printenv Minimal builtin clone of BSD printenv(1). push Anyone remember TOPS-20? realpath Canonicalize pathnames, resolving symlinks. rmdir Remove directory. sleep sleep for fractions of a second. strftime Loadable builtin interface to strftime(3). sync Sync the disks by forcing pending filesystem writes to complete. tee Duplicate standard input. tty Return terminal name. uname Print system information. unlink Remove a directory entry. whoami Print out username of current user.a Ws390zl35\SUSE Linux Enterprise 15SUSE LLC GPL-3.0-or-laterhttps://www.suse.com/System/Shellshttp://www.gnu.org/software/bash/bash.htmllinuxs390x 9p(h(@(p(((`((0((`(8(`(`@((0A큤a Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa Wa W768096ffca09a5b86c02c44e7a78167250eb5f73b493f18e168cf817a0ee4fd45002aae19def0ca750b4253db544e408336b5dd552391023a78da2c4c1f50a654e4e236064c5a6e4d6696574ac27932d6bb8b09255a6eb593b7d9d757faf003c57aab49fff453b7dedbc52bcdea77fb5506495a00af3157a8de31b353a24722e9c2e951165be1454c13f98c983020930f25f597c2118418cf3374c04610dc5622c0e29f3527be97b1940dd06a4ef42772f8a79e324b6a176a48878cc9d7eca3934947e42f82795265964a1dec39406fcfadf8d0d0c6c4628bc6e2f546ef0606229ce3ba84a519f83962e628de27a818c7c8fe81bf3c2ffa32e695c5fd1cc88496c8848a2a8c54aa7aad895bc5056f514b16a728d9ffc8f8c136b915b28db11f4d455b1c9d5dc03a045e2094fde74b4cfcdfb5cfd2eecb9f2ef9362486bc89579731c2b148208feae20b9faa3b117d0ee2e73804e70deaf884734365cbf196bc5dac2e8ecfa2743a0100a1db6d8e9add36deeae4046d6c37a6ed20d7a4d5520d404d030fc26230466431711fe52b0729b8f52d10d9aa19f3ac5a3b81ff34330a78f9b9675f7ceb570d02cd7076c92d909b3d696551fceb3eca16805157fb743ee0b497a50ec034f7454f6b73a34c022d37f61971d2aedf1a921bd19af0977b863d7f477cca443f1b60b9faa100b6de8c15cbeb769a7e2eb23e3be275b6a8a8faa26a46c68bbe4da4de52b7027810b481a466731310a561ec44f143df4f4a380b85547605961344c291d6d3f87015c7603cf8c2c29598b50343e2b08070d43ffd0b00c8708523f4cc2ee5d5e59e7ba0339efc86a97661bcd7c8db414475e3182509ba390c24b3e95fc23a7dc0e81aa8dee0f918b4a43004de4c1cdcc1e0a9788d69caa2e09f303890c4516afb44d9e8340bd28cf04ed1191a9a928f6c0afb03c9045c8e197f12eca9386894b695093b431fa26c06a26501908dce3c1980fca26a10ac8807123379f7d9c02e51d6dd39da94475fde06e6ad61fb42c4bd584f9b14ffa6c4fee60b2c5b1a95159defd18b56968ce949ff723139715de334241a57f3ca86423bd710a6ed50362343eba16a60afc4152d2718c332e76c06fa927b72d0103de74f4f5cc39ec4014d8b0cf43de9ab21ca4618d8b43aab33720f1ce74de66rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootbash-4.4-19.6.1.src.rpmbash-loadablesbash-loadables(s390-64)@@@    libc.so.6()(64bit)libc.so.6(GLIBC_2.2)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.1a @`7@_a@]V\t@[[@@[!@[)[Z3@ZH@ZZyZp^@Zhu@Z*~YY&@Y%uYX:@XX*X6@X@XJX<@X-X WWW;W9W~V޾V$@V UAU@Ug@UY@TTT~T@TT~@TXTJ?@TJ?@TG@TG@TFJwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.debwiedemann@suse.comwerner@suse.dewerner@suse.deavindra@opensuse.orgwerner@suse.dewerner@suse.defvogt@suse.comavindra@opensuse.orgavindra@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.debwiedemann@suse.combwiedemann@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.demliska@suse.czwerner@suse.dewerner@suse.deschwab@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comwerner@suse.demeissner@suse.comjdelvare@suse.dejdelvare@suse.dewerner@suse.dewerner@suse.dewerner@suse.dejdelvare@suse.dewerner@suse.dewerner@suse.debrian@aljex.comwerner@suse.dewerner@suse.debrian@aljex.com- Add patch bash-4.4-jobctrl.patch to allow process group asignment even for modern kernels (bsc#1057452, bsc#1188287)- Add patch bsc1183064.patch * Fix bug bsc#1183064: Segfault from reading a history file not starting with # with HISTTIMEFORMAT set and history_multiline_entries nonzero and with the history cleared and read on the same input line.- Move /bin/bash to /usr/bin/bash and provide old location as symbolic link of new location (jsc#SLE-15652) - Remove minimal sh build option as not used- Rework patch readline-7.0-screen.patch again for bug boo#1143055 * Map all "screen(-xxx)?.yyy(-zzz)?" to "screen" as well as map "konsole(-xxx)?" and "gnome(-xxx)?" to "xterm"- Add patch bash-4.4-bgpoverflow.patch which is a backport from bash 5.0 to perform better with large numbers of sub processes (bsc#1133773)- Rework patch readline-7.0-screen.patch- Add bash-memmove.patch to make bash.html build reproducible (boo#1100488)- Add patch readline-7.0-screen.patch to be able to parse settings in inputrc for all screen TERM variables starting with "screen." to fix boo#1095661- In patch bash-4.4.dif avoid setgroups(2) but use initgroups(3) (boo#1095670)- Add patch 20, 21, 22 and 23 to bash-4.4-patches.tar.bz2 * 20: In circumstances involving long-running scripts that create and reap many processes, it is possible for the hash table bash uses to store exit statuses from asynchronous processes to develop loops. This patch fixes the loop causes and adds code to detect any future loops. * 21: A SIGINT received inside a SIGINT trap handler can possibly cause the shell to loop. * 22: There are cases where a failing readline command (e.g., delete-char at the end of a line) can cause a multi-character key sequence to `back up' and attempt to re-read some of the characters in the sequence. * 23: When sourcing a file from an interactive shell, setting the SIGINT handler to the default and typing ^C will cause the shell to exit. - remove bash-4.4-wait-sigint-handler.patch (upstreamed)- Add patch bash-4.4-wait-sigint-handler.patch to fix bug bsc#1086247 that is repeating self inserting trap due external command in the trap.- Create readline-devel-static package to re-enable static libraries again (boo#1082913)- Use %license (boo#1082318)- Add patch 19 to bash-4.4-patches.tar.bz2 * With certain values for PS1, especially those that wrap onto three or more lines, readline will miscalculate the number of invisible characters, leading to crashes and core dumps.- Add patches 13-18 to bash-4.4-patches.tar.bz2 * 13: If a here-document contains a command substitution, the command substitution can get access to the file descriptor used to write the here-document. * 14: Under some circumstances, functions that return via the `return' builtin do not clean up memory they allocated to keep track of FIFOs. * 15: Process substitution can leak internal quoting to the parser in the invoked subshell. * 16: Bash can perform trap processing while reading command substitution output instead of waiting until the command completes. * 17: There is a memory leak when `read -e' is used to read a line using readline. * 18: Under certain circumstances (e.g., reading from /dev/zero), read(2) will not return -1 even when interrupted by a signal. The read builtin needs to check for signals in this case. - partial cleanup with spec-cleaner- Modify patch bash-4.3-pathtemp.patch to avoid crash at full file system (boo#1076909)- Enable multibyte characters by default- Modify patch bash-4.4.dif to let bashline.h install as well as this header file is included by general.h due to the same patch (boo#1060069)- Make build reproducible in spite of profile based optimizations (boo#1040589)- Allow to disable do_profiling in builds (related to boo#1040589)- Simplify patch readline-5.2-conf.patch- Do not throw info and manual pages away- Remove bash-4.0-async-bnc523667.dif as this one is fixed (and was disabled and nobody had reported trouble)- Add upstream patch readline70-002 which replace old one There is a race condition in add_history() that can be triggered by a fatal signal arriving between the time the history length is updated and the time the history list update is completed. A later attempt to reference an invalid history entry can cause a crash. - Add upstream patch readline70-003 Readline-7.0 uses pselect(2) to allow readline to handle signals that do not interrupt read(2), such as SIGALRM, before reading another character. The signal mask used in the pselect call did not take into account signals the calling application blocked before calling readline().- Add upstream patch bash44-006 Out-of-range negative offsets to popd can cause the shell to crash attempting to free an invalid memory block. - Remove patch popd-offset-overflow.patch to use bash44-006 - Add upstream patch bash44-007 When performing filename completion, bash dequotes the directory name being completed, which can result in match failures and potential unwanted expansion. - Duplicate bash44-007 as readline70-002 as it seems to be missed - Add upstream patch bash44-008 Under certain circumstances, bash will evaluate arithmetic expressions as part of reading an expression token even when evaluation is suppressed. This happens while evaluating a conditional expression and skipping over the failed branch of the expression. - Add upstream patch bash44-009 There is a race condition in add_history() that can be triggered by a fatal signal arriving between the time the history length is updated and the time the history list update is completed. A later attempt to reference an invalid history entry can cause a crash. - Add upstream patch bash44-010 Depending on compiler optimizations and behavior, the `read' builtin may not save partial input when a timeout occurs. - Add upstream patch bash44-011 Subshells begun to run command and process substitutions may attempt to set the terminal's process group to an incorrect value if they receive a fatal signal. This depends on the behavior of the process that starts the shell. - Add upstream patch bash44-012 When -N is used, the input is not supposed to be split using $IFS, but leading and trailing IFS whitespace was still removed.- Remove -L option on screen call dues API change, now we depend on environment variables only.- Enable -fprofile-correction to cover misleading profile created due to terminating_signal which does not return.- Add upstream patch popd-offset-overflow.patch to fix boo#1010845 CVE-2016-9401: bash: popd controlled free (Segmentation fault) Remark: this is a simple Segmentation fault, no security risk- Add upstream patch bash44-001 Bash-4.4 changed the way the history list is initially allocated to reduce the number of reallocations and copies. Users who set HISTSIZE to a very large number to essentially unlimit the size of the history list will get memory allocation errors - Add upstream patch bash44-002 Bash-4.4 warns when discarding NUL bytes in command substitution output instead of silently dropping them. This patch changes the warnings from one per NUL byte encountered to one warning per command substitution. - Drop no-null-warning.patch as bash44-002 is official replacement - Add upstream patch bash44-003 Specially-crafted input, in this case an incomplete pathname expansion bracket expression containing an invalid collating symbol, can cause the shell to crash. - Add upstream patch bash44-004 There is a race condition that can result in bash referencing freed memory when freeing data associated with the last process substitution. - Add upstream patch bash44-005 Under certain circumstances, a simple command is optimized to eliminate a fork, resulting in an EXIT trap not being executed. (boo#1008459) - Add upstream patch readline70-001 Readline-7.0 changed the way the history list is initially allocated to reduce the number of reallocations and copies. Users who set the readline history-size variable to a very large number to essentially unlimit the size of the history list will get memory allocation errors- no-null-warning.patch: Don't warn about null bytes in command substitution- Avoid confusing library path- Update bash 4.4 final * Latest bug fixes since 4.4 rc2 - Update readline 7.0 final * Latest bug fixes since 7.0 rc2 * New application-callable function: rl_pending_signal(): returns the signal number of any signal readline has caught but not yet handled. * New application-settable variable: rl_persistent_signal_handlers: if set to a non-zero value, readline will enable the readline-6.2 signal handler behavior in callback mode: handlers are installed when rl_callback_handler_install is called and removed removed when a complete line has been read. - Drop patch bash-4.3-async-bnc971410.dif as this one is part of 4.4 - Drop patch bash-3.2-longjmp.dif as now long time be fixed - Drop patch bash-4.3-headers.dif as loadables now simply work - Drop readline-6.1-wrap.patch as this seems to be fixed - Disable patch bash-4.0-async-bnc523667.dif for now as it seems to be fixed in an other way- Update bash 4.4 rc2 -- Bugfixes - Update readline 7.0 rc2 -- Bugfixes- Make clear that the files /etc/profile as well as /etc/bash.bashrc may source other files as well even if the bash does not. Therefore modify patch bash-4.1-bash.bashrc.dif (bsc#959755)- Update bash 4.4 beta 2 * Value conversions (arithmetic expansions, case modification, etc.) now happen when assigning elements of an array using compound assignment. * There is a new option settable in config-top.h that makes multiple directory arguments to `cd' a fatal error. * Bash now uses mktemp() when creating internal temporary files; it produces a warning at build time on many Linux systems. - Update to readline library 7.0 beta 2 (not enabled as not standalone) * The default binding for ^W in vi mode now uses word boundaries specified by Posix (vi-unix-word-rubout is bindable command name). * rl_clear_visible_line: new application-callable function; clears all screen lines occupied by the current visible readline line. * rl_tty_set_echoing: application-callable function that controls whether or not readline thinks it is echoing terminal output. * Handle >| and strings of digits preceding and following redirection specifications as single tokens when tokenizing the line for history expansion. * Fixed a bug with displaying completions when the prefix display length is greater than the length of the completions to be displayed. * The :p history modifier now applies to the entire line, so any expansion specifying :p causes the line to be printed instead of expanded.- Update bash 4.4 release candidate 1 * There is now a settable configuration #define that will cause the shell to exit if the shell is running setuid without the -p option and setuid to the real uid fails. * Command and process substitutions now turn off the `-v' option when executing, as other shells seem to do. * The default value for the `checkhash' shell option may now be set at compile time with a #define. * The `mapfile' builtin now has a -d option to use an arbitrary character as the record delimiter, and a -t option to strip the delimiter as supplied with -d. * The maximum number of nested recursive calls to `eval' is now settable in config-top.h; the default is no limit. * The `-p' option to declare and similar builtins will display attributes for named variables even when those variables have not been assigned values (which are technically unset). * The maximum number of nested recursive calls to `source' is now settable in config-top.h; the default is no limit. * All builtin commands recognize the `--help' option and print a usage summary. * Bash does not allow function names containing `/' and `=' to be exported. * The `ulimit' builtin has new -k (kqueues) and -P (pseudoterminals) options. * The shell now allows `time ; othercommand' to time null commands. * There is a new `--enable-function-import' configuration option to allow importing shell functions from the environment; import is enabled by default. * `printf -v var ""' will now set `var' to the empty string, as if `var=""' had been executed. * GLOBIGNORE, the pattern substitution word expansion, and programmable completion match filtering now honor the value of the `nocasematch' option. * There is a new ${parameter@spec} family of operators to transform the value of `parameter'. * Bash no longer attempts to perform compound assignment if a variable on the rhs of an assignment statement argument to `declare' has the form of a compound assignment (e.g., w='(word)' ; declare foo=$w); compound assignments are accepted if the variable was already declared as an array, but with a warning. * The declare builtin no longer displays array variables using the compound assignment syntax with quotes; that will generate warnings when re-used as input, and isn't necessary. * Executing the rhs of && and || will no longer cause the shell to fork if it's not necessary. * The `local' builtin takes a new argument: `-', which will cause it to save and the single-letter shell options and restore their previous values at function return. * `complete' and `compgen' have a new `-o nosort' option, which forces readline to not sort the completion matches. * Bash now allows waiting for the most recent process substitution, since it appears as $!. * The `unset' builtin now unsets a scalar variable if it is subscripted with a `0', analogous to the ${var[0]} expansion. * `set -i' is no longer valid, as in other shells. * BASH_SUBSHELL is now updated for process substitution and group commands in pipelines, and is available with the same value when running any exit trap. * Bash now checks $INSIDE_EMACS as well as $EMACS when deciding whether or not bash is being run in a GNU Emacs shell window. * Bash now treats SIGINT received when running a non-builtin command in a loop the way it has traditionally treated running a builtin command: running any trap handler and breaking out of the loop. * New variable: EXECIGNORE; a colon-separate list of patterns that will cause matching filenames to be ignored when searching for commands. * Aliases whose value ends in a shell metacharacter now expand in a way to allow them to be `pasted' to the next token, which can potentially change the meaning of a command (e.g., turning `&' into `&&'). * `make install' now installs the example loadable builtins and a set of bash headers to use when developing new loadable builtins. * `enable -f' now attempts to call functions named BUILTIN_builtin_load when loading BUILTIN, and BUILTIN_builtin_unload when deleting it. This allows loadable builtins to run initialization and cleanup code. * There is a new BASH_LOADABLES_PATH variable containing a list of directories where the `enable -f' command looks for shared objects containing loadable builtins. * The `complete_fullquote' option to `shopt' changes filename completion to quote all shell metacharacters in filenames and directory names. * The `kill' builtin now has a `-L' option, equivalent to `-l', for compatibility with Linux standalone versions of kill. * BASH_COMPAT and FUNCNEST can be inherited and set from the shell's initial environment. * inherit_errexit: a new `shopt' option that, when set, causes command substitutions to inherit the -e option. By default, those subshells disable - e. It's enabled as part of turning on posix mode. * New prompt string: PS0. Expanded and displayed by interactive shells after reading a complete command but before executing it. * Interactive shells now behave as if SIGTSTP/SIGTTIN/SIGTTOU are set to SIG_DFL when the shell is started, so they are set to SIG_DFL in child processes. * Posix-mode shells now allow double quotes to quote the history expansion character. * OLDPWD can be inherited from the environment if it names a directory. * Shells running as root no longer inherit PS4 from the environment, closing a security hole involving PS4 expansion performing command substitution. * If executing an implicit `cd' when the `autocd' option is set, bash will now invoke a function named `cd' if one exists before executing the `cd' builtin. - Update to readline library 7.0 release candidate 1 * The history truncation code now uses the same error recovery mechansim as the history writing code, and restores the old version of the history file on error. The error recovery mechanism handles symlinked history files. * There is a new bindable variable, `enable-bracketed-paste', which enables support for a terminal's bracketed paste mode. * The editing mode indicators can now be strings and are user-settable (new `emacs-mode-string', `vi-cmd-mode-string' and `vi-ins-mode-string' variables). Mode strings can contain invisible character sequences. Setting mode strings to null strings restores the defaults. * Prompt expansion adds the mode string to the last line of a multi-line prompt (one with embedded newlines). * There is a new bindable variable, `colored-completion-prefix', which, if set, causes the common prefix of a set of possible completions to be displayed in color. * There is a new bindable command `vi-yank-pop', a vi-mode version of emacs- mode yank-pop. * The redisplay code underwent several efficiency improvements for multibyte locales. * The insert-char function attempts to batch-insert all pending typeahead that maps to self-insert, as long as it is coming from the terminal. * rl_callback_sigcleanup: a new application function that can clean up and unset any state set by readline's callback mode. Intended to be used after a signal. * If an incremental search string has its last character removed with DEL, the resulting empty search string no longer matches the previous line. * If readline reads a history file that begins with `#' (or the value of the history comment character) and has enabled history timestamps, the history entries are assumed to be delimited by timestamps. This allows multi-line history entries. * Readline now throws an error if it parses a key binding without a terminating `:' or whitespace. - Remove patches which are upstream solved bash-3.2-longjmp.dif bash-4.3-headers.dif readline-6.1-wrap.patch - Rename patches bash-4.3.dif become bash-4.4.dif readline-6.3.dif become readline-7.0.dif - Refresh other patches as well- Define the USE_MKTEMP and USE_MKSTEMP cpp macros as the implementation is already there. - Add patch bash-4.3-pathtemp.patch to allow root to clear the file systems. Otherwise the completion does not work if /tmp if full (ENOSPC for here documents)- Remove --hash-size options as there is no any change in the final binary nor library anymore- Add upstream patch bash43-039 Using the output of `declare -p' when run in a function can result in variables that are invisible to `declare -p'. This problem occurs when an assignment builtin such as `declare' receives a quoted compound array assignment as one of its arguments. - Add upstream patch bash43-040 There is a memory leak that occurs when bash expands an array reference on the rhs of an assignment statement. - Add upstream patch bash43-041 There are several out-of-bounds read errors that occur when completing command lines where assignment statements appear before the command name. The first two appear only when programmable completion is enabled; the last one only happens when listing possible completions. - Add upstream patch bash43-042 There is a problem when parsing command substitutions containing `case' commands within pipelines that causes the parser to not correctly identify the end of the command substitution.- add bash-4.3-perl522.patch to fix texi2html for perl 5.22 (defined(@array) has been deprecated since at least 2012)- Add upstream patch bash43-034 If neither the -f nor -v options is supplied to unset, and a name argument is found to be a function and unset, subsequent name arguments are not treated as variables before attempting to unset a function by that name. - Add upstream patch bash43-035 A locale with a long name can trigger a buffer overflow and core dump. This applies on systems that do not have locale_charset in libc, are not using GNU libiconv, and are not using the libintl that ships with bash in lib/intl. - Add upstream patch bash43-036 When evaluating and setting integer variables, and the assignment fails to create a variable (for example, when performing an operation on an array variable with an invalid subscript), bash attempts to dereference a null pointer, causing a segmentation violation. - Add upstream patch bash43-037 If an associative array uses `@' or `*' as a subscript, `declare -p' produces output that cannot be reused as input. - Add upstream patch bash43-038 There are a number of instances where `time' is not recognized as a reserved word when the shell grammar says it should be.- move info deletion to %preun sections- bash-4.3-loadables.dif: One more warning fixed, in examples/loadables/logname.c. - bash-4.3-loadables.dif: Reverted one warning fix, which was introducing another warning and possibly a bug.- bash-4.3-loadables.dif: Split changes to shell.h to a separate patch "bash-4.3-include-unistd.dif", as the loadables build just fine without these changes. - bash-4.3-loadables.dif: Drop all header file inclusion fixups, upstream fixed the problem differently 5 years ago.- Do not restart all signal handlers for bash 4.3 as this breaks trap handler in subshells waotiug for a process- Remove -DMUST_UNBLOCK_CHLD(=1) as this breaks waitchild(2) on linux- Add upstream patch bash43-031 The new nameref assignment functionality introduced in bash-4.3 did not perform enough validation on the variable value and would create variables with invalid names. - Add upstream patch bash43-032 When bash is running in Posix mode, it allows signals -- including SIGCHLD -- to interrupt the `wait' builtin, as Posix requires. However, the interrupt causes bash to not run a SIGCHLD trap for all exited children. This patch fixes the issue and restores the documented behavior in Posix mode. - Add upstream patch bash43-033 Bash does not clean up the terminal state in all cases where bash or readline modifies it and bash is subsequently terminated by a fatal signal. This happens when the `read' builtin modifies the terminal settings, both when readline is active and when it is not. It occurs most often when a script installs a trap that exits on a signal without re-sending the signal to itself.- Fix the sed command that fixes up the patch headers. It was printing a duplicate header line, which suprisingly did not confuse patch, but could in the future. - Fix all patches that had the duplicate header line issue.- Use tail command to follow run-tests instead of a simpe cat command- Really remove obsolete patches- Skip autoconf on OS 10.2 or older- Avoid fdupes on SLES-10- Bump bash version to 4.3- Allow building on targets from SL 10.1 to current since it's frees390zl35 1628264439 4.4-19.6.14.4-19.6.1bashMakefile.incbasenamedirnamefinfoheadidlnlognamemkdirmypidpathchkprintprintenvpushrealpathrmdirsetpgidsleepstrftimesyncteetruefalsettyunameunlinkwhoami/lib64//lib64/bash/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.suse.de/SUSE:Maintenance:20735/SUSE_SLE-15-SP3_Update/dbd4b26ac789f65609097e2400bdfdb0-bash.SUSE_SLE-15-SP3_Updatecpioxz5s390x-suse-linux directorymakefile script, ASCII text, with very long linesELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=7a47379b73aa8d8a574dc8bea2d06b1456740789, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=95c776c87dd15bd35da14762ebca21317289a0f0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=8da204f9dbca219f2c8e9b63447a64323b87a128, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=bf03ce1e7465171bf85a0ad445a833c9a128bb1c, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=4445b61dd195cc9abb0ce552908b8e8dcf06e867, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=4f6ad3c6637c13341838a0dc4ca852f9ac3882cc, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=3bb9a5c02e820e1ae471bde9e49b9f63992f32eb, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=800656ecf4bef7015ad3ef36c9ff958cc2eb30e0, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=bf723666521b852a270a56caf9a875996ca0e3a5, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=113421fb18bbfdbe1728dee05209b19c9251ac0a, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=591eae66f07c2e2bcd1ad055c2e9a353df27d880, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=56af6a4102336b79b578f233f776420a50612325, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=8be98b0940d942152fa9ad19eeb0c8214d540b13, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=2409d9d9c499b7e4f094e177747c8cf7fb987e7f, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=a25919dd549b043c8d3f0517d89c4ee7e9276edf, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=24e9eadb61b26793a820d84317150505bc056b63, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=900d44d299f64f505feceb68339f9cedf127900c, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=6b0cbd627ab98e3de44711aa1b6d536d48fa06ff, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=f4cc1c0702b1a4195bd4c7d793def4e4641c9159, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=9e08d3f955d27768d7350a3d7512876733a6349b, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=4a8356d2ab698e39dc3d20579b389d0344940608, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=f9ce3b18706816fe24df98e9119d7ef6e3e35604, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=8be2a58018aa071f3a45965da8b2b0ce01194a1e, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=246a11cd82801819742b31a4ceb9983b9d79d2e6, strippedELF 64-bit MSB shared object, IBM S/390, version 1 (SYSV), dynamically linked, BuildID[sha1]=ef4b33f33ddb29b638f6d235cccfd593f2724526, stripped !$&),/1357:<RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRIU) }nrLutf-8769f720df076b989210e221bc1886f091aac417be31b385076ee5224935ee702? 7zXZ !t/j_k] crt:bLLxI6K6yѸΒ$tc1$5Bw5 o߹@-?/^,N O kkk7p׾/oXer9[`! M8Iq~ed=xnwOqHp!{x餘1Afz+Bgzgr16VI >`!&sJ uKڙ\@ )tF뽊K/6_@Ѵq,7Bŕt;1 }#f:A[ZmwȤF\s9[xÓhe 61m!N4BewGYėl ,#ʢֶ[ӈ"ʐ@)&9bf(QlZlυU7VE."Υ|&t+wIOY`00!)t]=bV 9딱 jMTFfX)54͇ 0\L/ egq 9ylI ~0 gBnv܀W\x' kD88 :*`JgYtJv/u$_L_㴀87.TE/J5%-+/D7Kx+70k[Q'q??it oVCGK.W5lAFtjm_GJ6ˀ )؊xvT$ܩą|>Tz^J9B{d(K7ꀵ;?cf>hǤI#$(P#(28ާ6dG?.?-[ŇS1<5^@՞B;#/b!'ӵ.]+͡bWQ#LpRK V%9EL"YPc t8J=0ďrxf(}*' z*PVÇ_Ύ].ޚXpl&U0f|+yoŗDM9RdJ~&W CR(L>2α; m Q}Y06OCRe ⚾{C`D }&2[3P'eXq]Xl8NoEk h+5/CP9~{A ý^ހUE:GC!~}$ Dad{Bչ8u9T a%[ G*rhK8ϳ/C ῏ﻂ0?Aw3؇hGl@kdZ.H4rN񄬹j>Ł` G@YZfR^C dr,7i5ń|1X:3F@3Mp7I].v;S}q,N"p؄HbEJ_dS(¬>ee+)s-=,VhimG@U_֧+aJ:I{Ty=+He!5wsrX#s dnJ47||Ks- RՐtjs-,TR ڻHZ.$ӣd\>޸k1I;rFB 0inS\:u`,AKD014')9O07ӹ7ś$Ղ/}K$cO}T☛`uOJ-[cЈK4ׁNjgRȷeQ?㻦ZFC5d3|eXzw5gF?2Њ:'J q]]l`ϙ~F̔P:LFYh\$9AuJi?+Y͐+'+G"YVtQg'!f$Gi, (]B:7c/1||&gׯ4e5hZ6 dw=I?ZbuK{'1H3lPB.=*OQC:0L<a@&GoNJyǚVUXƬ A!ťI?mY9U+ܖ[ J0T ŕ(X(0"ÒL2gQbsl ;jp^Ų0L?0E/CKR\SF;C'pd-+|u]MҢYD0IQI%#u(@P*6rQ *퀝mUל'R!JɝꭦA둹7O\$Q6Jg`nv*0ِb}kuH/Ā;!7n u"YJ6)Oe/JplpN ~`IE_Wtٷ :͑v 6K0*mzԈ@ۨFҥq(^c88L,ख+Y=ȶ@qb6ʉ'svꐣ gS .(J2w+ĜCIklDl1Gxvؤcm#HZ&NFbL(Q=̜V9v#Ek( Pa+:kEVL0f L]MJSQ9{Ekj v.r٩|Z![EbE]4z sn輜!V˗运w,־*ȴZҪQZ 7iZÙ| ;E8 JqlӚ;W΋~ÊW6]0c7δ8`heh H[352ƒ:$Xt /IwIИ?gjO|#5c?h5ek aN%EbM0A7ӧRGn!H.E쫳6]ۥ }*5`.M,߿07Mayi[ mQ$[^a]CN׬?ۊ u4|IMLh`iTҷdS: ؛ Q=kMawjg7R n4DO ov2A [vWBmٓͳ\QZ|^$pc#G jcxˑ_ `[]R 21' H\%Th$  ΉRZlb#ٙ,aN{q'NBu"=9D?8*>Kzs3H64#(_]TY7F1Ag)cb g,H&z#>B>?$HeH);>%~b)Hkqo㋓Ed-sۖSzҵ  TPΕUl粮%W?e)}.'2VcTV:[(x ΐ::NL 5V+d+r. QO) ^rBĝEr.֠QũҳM}&!}6Xf<tF9;q]Hβm|p9t.SԀ3Uj~VDtoV!G3|\ªw?H?HS',݁bE1o3~hi=W:+HәUPj8Kh ]Yw^$z? "n< Ϛ+6 !Saxϑ쎼|_Ds0 g'\YRQ,E(,= ~ LԵ~#@Tao qݩ8"4M^V0-AQva? a: Vϯ>ӎ׍v> +2Zn,b)FC zY{ E[F_P~{+bHuJFFCDI"lz^;ZʙwIŘ֑N[ _>yy㑅L}D w\<RnEp8sE DKsIC"/;Zjd=0 [TqI)|xU!v`8ʜ.[#h~iPvNgrEDeL:6s\mDdZ/jjEn&ͺ9r>`TF)dgFF" ِY)|Ess ?%l(%XLy/}ܤFʍCRhjCP?pQ&yP*aaq-?pv':ϊ늑x(Q g'XB4޿/b7mb[J{8yI*̇EjG8^ڄ 7B4's|͕))3c/V!:4qH+̉y+?}Ąnb%# җ:MUAgxAS/$tFGdS+Rp]Myw6t5eB$ }pzu殂ea}B9t DG^2Oqx.뉢R @9!4ؕ?:>/>@v1a؊*5fNpz", LBVɡKJd2\zFePHH)MXb"!pQlHlSIտmvҷ 'Ŵ URj58#ykyk %O$?<% (H #(7pTAdrfu2%. <ե`b;I`Z3z tA:;t:Fzv0J(\#e1Pn` YQV{C$k_E %J9/H+g;BJFmo@6LWkL<˩3 D.Z $#PSa?7BG22MqAcSjq'VđS#[̥@<+c_B x'{=~kX}<< \x?VޔPh#Mށ߈`\B z+15򹘓Z,"d V@ ObAPEc-z,< NiFFG~Pp! QHbF^ s91?ne9.bF?XGE`?{+?wMˡBh@͎@V"=[')9 FE^ [~8ƀ#ʌq]8V9m=J\i)D?~KoηUY_܉4bgq1\z O-tn'RpP |X%%"]NzJ#uzU%LJ/D3tKM[1B[f&΄b H$TrxO.U=MY,Xճ^>:fU:HL|R;SyƥMr)h]''K Oc`?|")y[/ei} #`S\M^UKpwr,{s$xaq2aDЄV֩hV{bR\Ono59X᱖^:d^E}sl :̸Ă<']Ղ qNzZ3U c]Ձ󦜤wĀz.˞r$$0'j쨇"+zNeڻ6tt#M0\XB *#+gj {U/P2x1yexLJ4HxloN azڨ5VY(GnJWل_+r$[`??bսt+"Vc:Tىŧ51bw"ġ2i8%3LJw:oMX;yD'q`pDĢU) ܢ:.lG"陗<+ޞ?'*_R Nq=<'E-8IETEcqu΀TG+ȱbq2>JփE R;n4@og$b$(~A <3NкFv?-6=xm7#:N0L6NTlMfٗs C,-l1 Alsg5@/0mٸu "6rpj\&=81T\#Έr/o[j>=z`z1g9n|Zg7"j.u܋6ɂZe¸W.U9ywhf4j9V ˲PJ,]!W-,؊ &̙1 }4~`-`fHotc6 Ոl< ǽ98HLX o.]6ƭ0ENtGz{iY {:]{M3M_:f\ 9- TK4^6):uB~U=3~&7O2B0( ,c>4\I0_VeHϒ+#ѥV}FPzQh uMt+">bJ//-ʹ(,b"e5yJuLers;eQ؃ڪA6c+ 7j9`Pm\r;@Ğ2d%V7{SJiQqqY_/ө8n}m|I`u>+ GYɏ9겥td1Jכnvr"Չ 31XS\j"vt 1 ̋^*JMc]WAyN&@ȲKwa;t}M-*ZybhM 7Gh?(.l6*USSwf UNK5@K|Fxq+=ˑ3<8Ji92Df{VMӾ U:Y΍> q@%a9V]zT|2j? CfYmѱL V1+~'ޭD8 ~FI7^^Tu xS|30ZğSm<2 JB#sA00 /%t;zN[XGBMה2IӦ Xҭ;tcAF?Ae~o`#K9@NP6Z>%e$T?}2p̏ȹ³ŏo;!aw؟~!#J)kˠR.]J|C<|4 a(`ly"%#R'N5Dӳ~,7K/P]a2l(+3̨ ϩR(o8^б5"Q P,(4PTW~~_A 1ߟH2y幅:gK{z?_i\̊FUe+q,bTi.]$jyuz.wŶsVuk2Ef9P»4=W5%4-x-}פ-SM$[Eq,B< Ɯa ϐra3OT@'Ƶ듆V]j穨2csBL4 /IgUn`. )sg:T]DW=n7^"E-)FJɋ<\{̒`|@g#8mJNb*Hh4M&g"tz- g3eHULx~Ax%JV qǙ}szH+60e}'RΪ ҴfMOU%du sO}.}e^~eUJͶދiMr\Jg8=,3?~bFbM3 R0cd';7)1ᦃu[%&;C]`5guЅEQW8+R …k*XL,ÐX،) %J̬JnS=v&)Ǎ|CgX+XylvFՋGT@L|@Zc셏f?EG}RK:'hp7)O~O.O/V WX1B<D7 i?YO{!/N!t'wYs 1!gk;Y'aHp(jߧّeL7qYfK& tG(l=b5 TxP~K)dTz^GExJ q&#Qg=-< }E'RrNtZ?@l`#e:U1ORV#^_}T`h:И>v|ؔv4x\XiB#!7s (;FC&qU)Q>fȯiO3OR?҉;3ƊgHc͞_`x#A*: ZGpzUIB8xK }2xF`w9 E{]ۍv,ؑ=vt/Yw\q–Nh%*-9_S˞F?`zGJXF{k]c?+c K;z(=9DjL>f, /\.8jq˚L|4;ώHB* Q5X}[GoP} S嫸p+!;tb`?;fŠK'LuǒCPXC2@ 8#&(*Pa)% iӃپ ^5ʉ zeP =Qv,*YR!1Y11RK>d ^cU&Nyx!Eݻ4Bkdjt#9,Nxߘ=sPbtW5#e;=0'`lя{qk$R؉tܨlj ӻs/·P6&h6w"up'DrTbZ|FCs ?sM _'}{$m٬a ښX{MN:lz z[^@~,Q ҪgЧ!V8A8`eyWxLdkӿ݄\o?i$LlG/7p|J$^~+{f'!o |Thѳsϗ.=ZmϿk겷/yb.-.R9oQs]4h,Gp޳;xfP}fe|:p(cÈ\+jl ~bGfSusGޚ446jww ޮM }2UqffL;;zE9b`;X4mOhf)?WYqC񽸁<_GЫam'd$yY k)ܳ0pS[ Q겨 ) |H%X-bU5c*#[#ZI=Iյʬ[ThV;c0-K=: 虂SdM\50^$S.N$wK^Yn!p8T&d3Ut{%CC令WVD'S윊i FN)MiC%`q-ܪ=Ix8tv?TGGDrLnĖ{uq6A0^~ٶTBuhluyqe2)RﴩѧL|MyfG͑U)LR1yn }hc0)Gu:҃"o.M'E+rD̟4o`mCvJ׵%KAtyԴ] Xo7%%-ofr &7f8"lJm2G.3G&Фu6ƞ(7UJXE@S1]áhh^0DN@c,"Dv홎G=;L^@q^}\䏪'-||I!~"qj YM%"v^ᩔSMbj ʡĽ! f}s }tMq-=ᢺr'h*Gi#IcWM[`{wu2 r^tT) P2! _R+)QIz6,[ kG@#w`DŔ;hߙ"Z!b6]G8]ɑåύf=&BI.{ }LTܝ"Ȫruq2Zz1`|Hb+ w\cË]kAQ]Ua F ͪ%'>=ln2a~)?9` b$tk;wBp URGJ5+p󨤐f.)TƷ:Cȧ%zÏ=:<$1G1CNI BNi'p*sͮtC :RԜ)պS ] Gi Jϗy^tVe(;e rT(rH2j˿-:Sr,  GrǦ-e=a]0s{^c[l{Ϸ & 0K7Zjl14"Z٨՝(.%)BɺĤLYn4 Eg*\-~I~> S{a:Z<1'2YAHK2aLT#MuftmkWBf5L뿦B>iCD'-g))¥XUw~&/ܗ,.L=bw2-ʐl]2Rߛ&ZlS(yBw4VQˀ$G<"V ,:Md$d}bk}Et.VLPl\THjyr4 X̙2F>"21Warh/3\5?kXWe&C>2thiwH]I*JaŘ8vѺhQ& J+ ]@nt)am*43TD}DBXbrT-> Ν}6 U'VK% l_]J#Rf|xghtP(Ց'3<"*L:a#I|[{R&۸39C>zmT'+cXy9Airv:gvlKԙxP?8덢˯_uDeZ`]BF rEaϱ+ G 6fzLI9x$tqm!ڙ2 L#T9kGNԴT6c#56!{^Sxq1e˄ Ύ&V1Č{?x]LۘܛBoQ4(.ԫN4BS 'a-]L2'+-Xˡ2B^*'^NwVx&$04rX-OnKxy3{`*o8{W6uiF 4P7MTQ͖E**n\=ƄÉ3KBF?% ՘[S4;h7f xWvV a^xғMR?Q/3,be8<| X"\~>5koEo,03Lqt%Bzǝϲgzz1Fh.+%YOVtVfl$ ⵧ{pn GLh(`,nvnV xDR(]8j =t'~OH=j~Zz5  J|EW>wHϯDO++\JX #DWμ $.tXC= vws9 \iLbӆ:z窍o`{Uih.ˈb^mD- ֿTEU6itxAA]d(-iH2Sa7|.FoAh.`Nn| hN0 #xOM{5kTpClWAj 35]6\cȲ]y.j/jKhLo.O2=96O< RY|dzlk*c}u8!G9kzffviX}Ú󆀹.XZե"5Z:c޿83ݥXu`_ ^aqFCyau()!/e?\">F33|ˎ^>Djs#[M(pf #ˬ6T %,|p2Hmݢ+q 䠐oG ]ZRRQru? '9ǕO.bŪS>p^b8l*}nۊ&LL`h˗?g.#Jc1:aK8*Lܡ{RĂ-j Pm93F"pP ǻ|Ov_>EEgR7&l#7; ϵwY,tN!S;p9L^>x֌;!*]!y,5ϏhۛtٽY<,Z"C Wڅh;)j͹%&MнPXaP\_Az3jKm+8oz.clƏHmeY5|F`A=-ZC\U 潗(li.KXt`GMc9J; kՎy떮qwT D3>TM׋eg1 k\JˇlÍ\fטrؘZBye9>mӘ"?kaڝ'X -It}VR+#3|@kI4 %W;NFGq,Mo ~҂=`5ᕘi,U)Ul}mO}! anyIZLlgA$%Ȥk«3*g7I?s&;ja4iw$"({a٤3V;9EPǷ b١Ņ鿣a_rr@yS$,PMPY[q צa=l+6wrR6K4mTFKea_@\~~8b(x5QĞ(. +:s5oڳa[ h=۫ Jʿzu(*!HH59hT-+mXD$J?b9PCGc\]k!Nկhɴ$}b>F`Z,.9!Zkh3xb~j# n+Ր,W]:+jxWqei4Wro6CeAbk,b2#O@u8Mf6B;.xLkm0LR,j/`PEtVMΑ+M{Mjr\*m2|gCtgv BS YDƽq(%J)\_/wƭWHjXEUkK O&G(׬3iєzϾ5GʠXbp#"WG,I%[r р~ zD|l;vM$zv5ؙL)L@Etu+_ZDɹf5%B;ƹ(n&Fݨ%tH_ABWb/tE$%ozXNd;խ%IqvEA WDGu{O_W)Tf<6A_?N. gd.@@'ɻ8}yOM`iaO!DqKFewn_ٱ1VXn{!zՕCWF-h=\&gm  K6p8*w:/90T E<{3wSp:85ވqJšbͳ svZ402{GLO`l3mLJ[4"{Aq2۩0"5)PgNpe]Ggփ\L ?=@s0^.d ΟA >dX FbL2gOOKk+rtm6Gp8x3Q4n<XF?B:߳5lsN6*ĝBϛ|3& RP>RQid[ :qR|t+|/ު˹ hO51ۣ`-ʨE%D_|X ?QH$TC.Bh{xgTD> 9Qb9w7[q "]Yx,or>PtlQ]\{d[%  az6:M@! ~ta4JbM=x|:qa*^ՙwoR85wB#o22`tTad9?#iǤ9Џ0f}{\LrTۢ2@eɺyc$!bQ9 7{g+n(PO$/8M{ZhƁESr dv 6 [=2%ѹ` Mk8at|=Bf1޳tbۘ&^ x_*h.'$ׇeׂr6 c? !OǛ353h AK# +x< (HB@le[{f',5D<@1$Ũ~7$r T17YxD`S5IZvR|q&.ŀ歶wWu 7M y/}GÙ (#5JJ#B.qF`c@nuwE6_& 4ޠE#Ayo7Li;k1=@}H^ S^Bp|1B)7#ůDLӤ9Z#"NU_qMnnySJCγfP3M7J!MD>4mbN@)H 9+ ~g%zMV[' MGZ& IwJWhrL^\-=0wL>+<&g] -~zR{l*\StB 5E52%uI:mg_DxW{=z^PFXyZ0Oy*D4h$ho^crt@R"lQئGD-Mqg?]0zy#H,ow/Mu~sUը_'%CB8:`Eb ga8`c#țXjYA,X3Iӧfr b:ڱΩ. w2gA0HtVǰM{츩I|;K]_uY#)z=Aa.JCݤ €JH_O*שw@g`^9AN?,B}KIa8/z 9M@fkfL$`U.nӛ)O\QL2ۺ-Ksd ;{pM69+H?_wK9k$MVu=99H,8wOnO̹΂GTHu{V0\WPֿg [e=cϟK"+!$>&Xc6 U ھ 7$O||# k!Z_  m,Ry!צDb%ږnOm!ݻBS,44#j0L mMbt(]wg*lx7/-BOۼ)`HPp ܋g1ک>9s}=?:[ @/J9}QUuɍ$6"73G>,.<=3gD~G ֡@Ba~zbfc0qqw;z WSP! Al4#ݸRMSD$w"&Ȁ]Gyղ@Y]?I4t#HYǍ0Tx!5Y)d]faʜ>7 ?|7R` xIcÓiagǾX] kaY#‡WZoj:cg`{?oXskZ|Z{r.Pi1+~3a ܣ^;OAD> -uV8à5hNR= +/6i'nL?|?'劼@oaSТ߀ G(TOoۊ4[QftՏU!n?e&0 zCX4DkUjKwⷀG@bDA74]5_N9@ ڑIbb)e[i3@+CGw}r@P1tD8)CS*†EFSgtfgmńT]~jyNKFưVF8&﹭_EGL!6GUgQ'Ģ^&n%ru( .)_C9+k.Q`uh@5sKRجJ/ I-BFYr-,*o4_vz2 D:b%JݦNR+ dS|J3Z듬yDghqNU< k?OWRZ9W!I8LkbgrVR|WiCagZVͨ dNunՒZx-,u&V' WTS~V| icաo)#QriB`s=TŷOt;)j-Lmí^BVf W p!%~xHEvP@ɀ=7$!?7$Xer/ oboR*d.WzC>EHkœl5e-L4+GĸLJ jG}}+q7}ЬcltAKBHq.C߰!d,xnj̘ٮz8s]LAjG4Hc'k>G@ =KZ~ L p;ԘZXlXTwN^AjwESIkVM ɂb/ ?¤,!ͯVm䡲JkOze!$z&.A'A-=shw0USf Lk!sxpQZJ++3JXu9-y\KTcq,ed*1{NhP`2Q)IHv3Nׂh}o&O* FW;ZѼd"R&B:vK}ꛚ[8>+ Ow!0 8}(-MP1IB߰c1b1<c'(U7hBmQ C3wG^D0kX)~Iֈ. ϒAbXotvq%8͆M!Y< 8^B : 7`: && rpUE3zqUfG7в]~3kAgfiC# }8訣mAeTSIwzc\(Mjoۮ1gاψsaG@ XL9tҏb; L6eݡ*bŐ^4'%G>-%5҃U`p&m^{&]R&g(7X;^Q7A [27*`T^6ְqsf]ihChyiHHɈ]G !US(]=-nSDK c&v.Ds<0`8T{Ԋ _uP-ʘ>9][gYәw0B z#,R% /4,e`Jsmtޠ, 4YR6Xhȿb "ݲǜ\@W#3ӿ~Ω_VEʆy>Rj^^lT7NZ#cf"\c6#Xĉkâ1ivl1Pj Cee*gzA0/-}q^Ae$i+6v-"DOg_`&rH]K? *,fנjiXYg}⎞$.& l ҵj EY{4$ G,M ŭHhf8H ћ[4[BA菴&>y )c9$bY OݸBW{= [3[P99fmU\|^5;%@f; v\<.Dwc|]|aq%L`~%0#ۦh@ e_Z:cɫݙtNwj"!#uY?H*d!{l4n- ܄F,O8{A uxOߝգX>0yMn0g)>y-(]qAw4 0kuBY,awu!!ԕa$QG},ZiªTr,((bdA? ph~f帔I^KLh=$"/{wAۍǒ)u-PĚ/剋p B05XmR٢I0z4SA$UNV7Djߟ44Wh35|i1;L^#8E7ˌlV ][ظ',$U? ȢyK]LteRy]#١ ق %v4s$nԃ44`xQy^+o#MF]}.$ܵCuEMo,R\Xc4ݦ6=+j n(2&InbzY+^Ij JVg_)A"b'\ `aY!Zm[+YQC ;~3/PP".[XȯȾ\EEPca1xMJd+j +4GvJ`c)QD^JWBtЗzǶ߰m|82\l`uBZQboK !:3@a31'b0j<H(؈B}.(~g [ne@KAߞEql\XubRg6" IE; ZO3-5nGO\dAl1ze B Wn}oJnN3ʷWBWl'fwh1U4츐;{O|ٵ3(X~ly@Й|SaFuIt rQ~D|~T2YhBJ筘eKl0ZL],Fp)o[ENUį_ 6Z^텝Yx9\^V9ݦ#Wd"@5S*gx k,MRlssi\Ӝ eD\/qx Upd#5dGh >9 *^_=!%pwTF^grJυٹXa!SWhVOk`L!(q]u箰?*s`iBk4VZ3X:%A.̿dH gFj8T1E[d@ӑ@pQ Xmyx& $unK%QD:0XbҋMdc6jD"Ő:ɴ^2~`E4C{+$JVE0wʠP"_Qe?Rf..VT4 =ч˧p2k&͐RY-s=qhE܏>dĝ[>wg h?cm|15δgZl3o.Pxs(}ב@ +52׸ _&~.;GVNXsgޘ"g!k{Nt6yuOO"'y@9W7nNB'aB>OA4Z(8IYГ$9nz+T2|ƥif3(`P I\g79nbs{ms :K^]% o([QRïj{!' 椟\ƆqGC:!}sNu2_.Q]zfH9:Q_Uwqh1,F.W}eU_}ҡvݪRFz!"; i2A2}pa6%-jFw/,s`]L<11Pͺt̩{ӭya2Iқ LK] y3ΉږtC(v*Hr"WN IU5~M<pkE/#9 J "^^XVOʄkɪEvכּpDdۧ+'& ?D◖,F^U S@ٷﵖ!jU@}p]Hj!$PFO'R-i }biU&4IYZ축=s[mҫDAU2؂K)Lvr_+aH?JtpccnOKwT|PQZn٦T!1mi:}8'2w\(g"khNK}75㜟" 43U _qEG7\myg  ԻHGI_,_&{*nvV@W}ƒv KdA֜Ч0S3[F9AoX+bx.&/|@VI"ڜڼd?w`xt4Z,19{:2v‡Pv'⮯-oa+R^ė`@ZFI>kc z;Pti`wG: ((O%ивO[Q ,z!zN 2S`ddML~]I0 :ބ uзP= `k;v~3#0O;? -mt^˘ՏqM 4issARacXUb3.-pVldƣELp c֟[t3AdC%Q),O…fDFpNE@НPf4pBa%VHB Y)Rs,J3b.^{ #XSYn*m^eҽ0\:U"O޸jy]\o\1&&3b! |+{U A#A@W!oڦC | U4vC0x%ތ˅mQ=r), o8 +*Uh & [% YZ