bash-loadables-4.4-lp150.8.3.1 4>$  Ap[dd/=„1>a%u[5*x 22 ,iP ]'G>d'<Te \9."o8Bl3ZsYn,;&sL2>`'0NiRń0Iζeբq|C>%:_[qf]KfVJ gwHrsS>(?E{ KUƐ.<D]#8I DӴ۴CJm3u$wAh0d990b8a17594b29694bf5b0d3ceeb633d4369c9a993dc47eba2d937a979febfe41d5d6da1df5f27228f587221af52dc07c304cdĉ[dd/=„l@V MKaDOIuNJ>b-wNTo ߤaX0G`! P.dBJ/_@ېpC_|!naaRF˟R ]7%*K+![tEü2jnNˏKo^.]EzIe([2|F>e]?cm:| 䕭#IO,"֍U5wM ai+p윊-% m/3}_%@B&g>p>?d ! 8 *8cip  H   O  l _p(89,:F"G8HIX,Y4\T]^ubc3defluvHwLxy$Bz,<@FCbash-loadables4.4lp150.8.3.1Loadable bash builtinsThis package contains the examples for the ready-to-dynamic-load builtins found in the source tar ball of the bash: basename Return non-directory portion of pathname. cut cut(1) replacement. dirname Return directory portion of pathname. finfo Print file info. getconf POSIX.2 getconf utility. head Copy first part of files. id POSIX.2 user identity. ln Make links. logname Print login name of current user. mkdir Make directories. pathchk Check pathnames for validity and portability. print Loadable ksh-93 style print builtin. printenv Minimal builtin clone of BSD printenv(1). push Anyone remember TOPS-20? realpath Canonicalize pathnames, resolving symlinks. rmdir Remove directory. sleep sleep for fractions of a second. strftime Loadable builtin interface to strftime(3). sync Sync the disks by forcing pending filesystem writes to complete. tee Duplicate standard input. tty Return terminal name. uname Print system information. unlink Remove a directory entry. whoami Print out username of current user.[dLcloud124YopenSUSE Leap 15.0openSUSEGPL-3.0-or-laterhttp://bugs.opensuse.orgSystem/Shellshttp://www.gnu.org/software/bash/bash.htmllinuxx86_64 9)())h)) )(((x(X((A큤[dF[dE[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dF[dFafec72c3dfbbb56c8ee7610aebaee2bd6ffca01bf0ff84afffd43f232efd3576f4db03368741881c7012cca5cb189188018454817bc7e72288c6099e539ad6913ed05bd7311f4210438e13450261306361190acaeff396240076f0566626d3e6eaa15581687aa1ed80ea0e8cf518d31e64e02cbb90b0793fd9314a4a04f516ab23c60402f7c7c21ac0c6a39e94c92c11a1cf23a3f1b7c499a9fb95f4873b5e5b6eefaf966ca14d9c3c0c52dbd138b62e4c2b09b2af54b0e5d42f7ea0c0026b390f5f1bddc8cd19623797e21815a3f663376c7d9772a5e4a321799acd6f8986a48a5b0f1e8a2dbf0f95d5d5ac32d86317ca021104a0d1aaecd6f8544afc6c0ff001a3d1e7773518c40567b06ab3a167ea899354bd827e38e6998f6f3e488111931c3856bc1deae2605a537183dc954712b5f76f1deb7b4fd8d3a2c47978494e18d15c2fa2c580425883d9532b6a27096f309f1392ecaebcd234b7302a92a981004c622fb39a8738a65655e3098cbfb075996401fa1eca2d03426311a784633220e90f8ea4a09168dcc481b835a6ed33ad9bf619c51a7d7c75df348b0d1a6cb2ccde1c066b4bcefb7d6a3da71a7dc0a118f400d71367d1b93365a32e3e64ca33f77fa1e05f8182c92e32f8bff23e13763b77088c48082242f5679358ff24334a532a2f33c8d17e60a18fd19535aa2c1cc088cdd70c9aa5f261d8d3f70b16d1b56ac01d798bbe20b030fa489bd0141b950b5783accb69e4bdb1dbdee041604d2cdb89d180e8b28d4c938a3775d9caa32909c94b4ba32dc4b21bdf868f1cd2427cebe0e843b7be1abce247d841e2eb72d8459d0b9ad976b035af0f0aa457541dd424c9307d81b35537305be7aad0c7a36e9d41c2e1de9e7e0101e34dcf127720b3848bf31dfec1550a707dcd2c74387f221ee03c89e47b1193cfadc838e1289c24abb182312db24103ac6d394c2f0861945a57aee4ce469463a3854a0df4578204462c2ea41a0a63dffe929a52b104a2163124320f51c7bf8f4552d0298291e1a53f3b3074d91d233890cb15ad771c223b14d05db11710d146a7d61e8c31e260b4e8579ac8e39fd510bd4e91b36f707b82ff632f2392038cf170271d91abdb3483bd6620b0d19985a7b1173d1d1aa65582116b383eddd26d142fe696d228d2ce90a3rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootbash-4.4-lp150.8.3.1.src.rpmbash-loadablesbash-loadables(x86-64)@@@@    libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.14.1[[@@[!@[)[Z3@ZH@ZZyZp^@Zhu@Z*~YY&@Y%uYX:@XX*X6@X@XJX<@X-X WWW;W9W~V޾V$@V UAU@Ug@UY@TTT~T@TT~@TXTJ?@TJ?@TG@TG@TFJT2@T*@T)IT%U@T@S<@SS{CS`SO@SO@SM@S:@S(5@R@QQکQQ@QJ@QC @Q.P[P @P @P@P~P7lP H@PP@P@OO@OO@O}@O_6OYOU@OU@NxN'@Nσ@Nσ@N=@NHNåN@N@N0NNNw.NMAM@MM@MTMwkMv@Mv@MtM] MY@M4/@L6LL@Li(@Le3LQm@LD>@LA@L#HL#HKK @K"@K8@K@KK}+Ky7@K(K#KJJH@JJJ#Jn@JL@J.NJ&eJ@J@I@I@I@IzIܑI?@I@IV@Im@Im@Im@Dr. Werner Fink bwiedemann@suse.comwerner@suse.dewerner@suse.deavindra@opensuse.orgwerner@suse.dewerner@suse.defvogt@suse.comavindra@opensuse.orgavindra@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.debwiedemann@suse.combwiedemann@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.demliska@suse.czwerner@suse.dewerner@suse.deschwab@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comwerner@suse.demeissner@suse.comjdelvare@suse.dejdelvare@suse.dewerner@suse.dewerner@suse.dewerner@suse.dejdelvare@suse.dewerner@suse.dewerner@suse.debrian@aljex.comwerner@suse.dewerner@suse.debrian@aljex.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.deschwab@linux-m68k.orgwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comwerner@suse.dewerner@suse.dewerner@suse.deschwab@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decfarrell@suse.comwerner@suse.demeissner@suse.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comcoolo@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@suse.comwerner@suse.decoolo@novell.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@novell.comwerner@suse.dewerner@suse.dejslaby@suse.dewerner@suse.decristian.rodriguez@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decristian.rodriguez@opensuse.orgwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dero@suse.dewerner@suse.dewerner@suse.dewerner@suse.dejengelh@medozas.dejengelh@medozas.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.decoolo@novell.comwerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerne@suse.dewerne@suse.dewerne@suse.dewerne@suse.dewerne@suse.dewerne@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.dewerner@suse.de- Rework patch readline-7.0-screen.patch- Add bash-memmove.patch to make bash.html build reproducible (boo#1100488)- Add patch readline-7.0-screen.patch to be able to parse settings in inputrc for all screen TERM variables starting with "screen." to fix boo#1095661- In patch bash-4.4.dif avoid setgroups(2) but use initgroups(3) (boo#1095670)- Add patch 20, 21, 22 and 23 to bash-4.4-patches.tar.bz2 * 20: In circumstances involving long-running scripts that create and reap many processes, it is possible for the hash table bash uses to store exit statuses from asynchronous processes to develop loops. This patch fixes the loop causes and adds code to detect any future loops. * 21: A SIGINT received inside a SIGINT trap handler can possibly cause the shell to loop. * 22: There are cases where a failing readline command (e.g., delete-char at the end of a line) can cause a multi-character key sequence to `back up' and attempt to re-read some of the characters in the sequence. * 23: When sourcing a file from an interactive shell, setting the SIGINT handler to the default and typing ^C will cause the shell to exit. - remove bash-4.4-wait-sigint-handler.patch (upstreamed)- Add patch bash-4.4-wait-sigint-handler.patch to fix bug bsc#1086247 that is repeating self inserting trap due external command in the trap.- Create readline-devel-static package to re-enable static libraries again (boo#1082913)- Use %license (boo#1082318)- Add patch 19 to bash-4.4-patches.tar.bz2 * With certain values for PS1, especially those that wrap onto three or more lines, readline will miscalculate the number of invisible characters, leading to crashes and core dumps.- Add patches 13-18 to bash-4.4-patches.tar.bz2 * 13: If a here-document contains a command substitution, the command substitution can get access to the file descriptor used to write the here-document. * 14: Under some circumstances, functions that return via the `return' builtin do not clean up memory they allocated to keep track of FIFOs. * 15: Process substitution can leak internal quoting to the parser in the invoked subshell. * 16: Bash can perform trap processing while reading command substitution output instead of waiting until the command completes. * 17: There is a memory leak when `read -e' is used to read a line using readline. * 18: Under certain circumstances (e.g., reading from /dev/zero), read(2) will not return -1 even when interrupted by a signal. The read builtin needs to check for signals in this case. - partial cleanup with spec-cleaner- Modify patch bash-4.3-pathtemp.patch to avoid crash at full file system (boo#1076909)- Enable multibyte characters by default- Modify patch bash-4.4.dif to let bashline.h install as well as this header file is included by general.h due to the same patch (boo#1060069)- Make build reproducible in spite of profile based optimizations (boo#1040589)- Allow to disable do_profiling in builds (related to boo#1040589)- Simplify patch readline-5.2-conf.patch- Do not throw info and manual pages away- Remove bash-4.0-async-bnc523667.dif as this one is fixed (and was disabled and nobody had reported trouble)- Add upstream patch readline70-002 which replace old one There is a race condition in add_history() that can be triggered by a fatal signal arriving between the time the history length is updated and the time the history list update is completed. A later attempt to reference an invalid history entry can cause a crash. - Add upstream patch readline70-003 Readline-7.0 uses pselect(2) to allow readline to handle signals that do not interrupt read(2), such as SIGALRM, before reading another character. The signal mask used in the pselect call did not take into account signals the calling application blocked before calling readline().- Add upstream patch bash44-006 Out-of-range negative offsets to popd can cause the shell to crash attempting to free an invalid memory block. - Remove patch popd-offset-overflow.patch to use bash44-006 - Add upstream patch bash44-007 When performing filename completion, bash dequotes the directory name being completed, which can result in match failures and potential unwanted expansion. - Duplicate bash44-007 as readline70-002 as it seems to be missed - Add upstream patch bash44-008 Under certain circumstances, bash will evaluate arithmetic expressions as part of reading an expression token even when evaluation is suppressed. This happens while evaluating a conditional expression and skipping over the failed branch of the expression. - Add upstream patch bash44-009 There is a race condition in add_history() that can be triggered by a fatal signal arriving between the time the history length is updated and the time the history list update is completed. A later attempt to reference an invalid history entry can cause a crash. - Add upstream patch bash44-010 Depending on compiler optimizations and behavior, the `read' builtin may not save partial input when a timeout occurs. - Add upstream patch bash44-011 Subshells begun to run command and process substitutions may attempt to set the terminal's process group to an incorrect value if they receive a fatal signal. This depends on the behavior of the process that starts the shell. - Add upstream patch bash44-012 When -N is used, the input is not supposed to be split using $IFS, but leading and trailing IFS whitespace was still removed.- Remove -L option on screen call dues API change, now we depend on environment variables only.- Enable -fprofile-correction to cover misleading profile created due to terminating_signal which does not return.- Add upstream patch popd-offset-overflow.patch to fix boo#1010845 CVE-2016-9401: bash: popd controlled free (Segmentation fault) Remark: this is a simple Segmentation fault, no security risk- Add upstream patch bash44-001 Bash-4.4 changed the way the history list is initially allocated to reduce the number of reallocations and copies. Users who set HISTSIZE to a very large number to essentially unlimit the size of the history list will get memory allocation errors - Add upstream patch bash44-002 Bash-4.4 warns when discarding NUL bytes in command substitution output instead of silently dropping them. This patch changes the warnings from one per NUL byte encountered to one warning per command substitution. - Drop no-null-warning.patch as bash44-002 is official replacement - Add upstream patch bash44-003 Specially-crafted input, in this case an incomplete pathname expansion bracket expression containing an invalid collating symbol, can cause the shell to crash. - Add upstream patch bash44-004 There is a race condition that can result in bash referencing freed memory when freeing data associated with the last process substitution. - Add upstream patch bash44-005 Under certain circumstances, a simple command is optimized to eliminate a fork, resulting in an EXIT trap not being executed. (boo#1008459) - Add upstream patch readline70-001 Readline-7.0 changed the way the history list is initially allocated to reduce the number of reallocations and copies. Users who set the readline history-size variable to a very large number to essentially unlimit the size of the history list will get memory allocation errors- no-null-warning.patch: Don't warn about null bytes in command substitution- Avoid confusing library path- Update bash 4.4 final * Latest bug fixes since 4.4 rc2 - Update readline 7.0 final * Latest bug fixes since 7.0 rc2 * New application-callable function: rl_pending_signal(): returns the signal number of any signal readline has caught but not yet handled. * New application-settable variable: rl_persistent_signal_handlers: if set to a non-zero value, readline will enable the readline-6.2 signal handler behavior in callback mode: handlers are installed when rl_callback_handler_install is called and removed removed when a complete line has been read. - Drop patch bash-4.3-async-bnc971410.dif as this one is part of 4.4 - Drop patch bash-3.2-longjmp.dif as now long time be fixed - Drop patch bash-4.3-headers.dif as loadables now simply work - Drop readline-6.1-wrap.patch as this seems to be fixed - Disable patch bash-4.0-async-bnc523667.dif for now as it seems to be fixed in an other way- Update bash 4.4 rc2 -- Bugfixes - Update readline 7.0 rc2 -- Bugfixes- Make clear that the files /etc/profile as well as /etc/bash.bashrc may source other files as well even if the bash does not. Therefore modify patch bash-4.1-bash.bashrc.dif (bsc#959755)- Update bash 4.4 beta 2 * Value conversions (arithmetic expansions, case modification, etc.) now happen when assigning elements of an array using compound assignment. * There is a new option settable in config-top.h that makes multiple directory arguments to `cd' a fatal error. * Bash now uses mktemp() when creating internal temporary files; it produces a warning at build time on many Linux systems. - Update to readline library 7.0 beta 2 (not enabled as not standalone) * The default binding for ^W in vi mode now uses word boundaries specified by Posix (vi-unix-word-rubout is bindable command name). * rl_clear_visible_line: new application-callable function; clears all screen lines occupied by the current visible readline line. * rl_tty_set_echoing: application-callable function that controls whether or not readline thinks it is echoing terminal output. * Handle >| and strings of digits preceding and following redirection specifications as single tokens when tokenizing the line for history expansion. * Fixed a bug with displaying completions when the prefix display length is greater than the length of the completions to be displayed. * The :p history modifier now applies to the entire line, so any expansion specifying :p causes the line to be printed instead of expanded.- Update bash 4.4 release candidate 1 * There is now a settable configuration #define that will cause the shell to exit if the shell is running setuid without the -p option and setuid to the real uid fails. * Command and process substitutions now turn off the `-v' option when executing, as other shells seem to do. * The default value for the `checkhash' shell option may now be set at compile time with a #define. * The `mapfile' builtin now has a -d option to use an arbitrary character as the record delimiter, and a -t option to strip the delimiter as supplied with -d. * The maximum number of nested recursive calls to `eval' is now settable in config-top.h; the default is no limit. * The `-p' option to declare and similar builtins will display attributes for named variables even when those variables have not been assigned values (which are technically unset). * The maximum number of nested recursive calls to `source' is now settable in config-top.h; the default is no limit. * All builtin commands recognize the `--help' option and print a usage summary. * Bash does not allow function names containing `/' and `=' to be exported. * The `ulimit' builtin has new -k (kqueues) and -P (pseudoterminals) options. * The shell now allows `time ; othercommand' to time null commands. * There is a new `--enable-function-import' configuration option to allow importing shell functions from the environment; import is enabled by default. * `printf -v var ""' will now set `var' to the empty string, as if `var=""' had been executed. * GLOBIGNORE, the pattern substitution word expansion, and programmable completion match filtering now honor the value of the `nocasematch' option. * There is a new ${parameter@spec} family of operators to transform the value of `parameter'. * Bash no longer attempts to perform compound assignment if a variable on the rhs of an assignment statement argument to `declare' has the form of a compound assignment (e.g., w='(word)' ; declare foo=$w); compound assignments are accepted if the variable was already declared as an array, but with a warning. * The declare builtin no longer displays array variables using the compound assignment syntax with quotes; that will generate warnings when re-used as input, and isn't necessary. * Executing the rhs of && and || will no longer cause the shell to fork if it's not necessary. * The `local' builtin takes a new argument: `-', which will cause it to save and the single-letter shell options and restore their previous values at function return. * `complete' and `compgen' have a new `-o nosort' option, which forces readline to not sort the completion matches. * Bash now allows waiting for the most recent process substitution, since it appears as $!. * The `unset' builtin now unsets a scalar variable if it is subscripted with a `0', analogous to the ${var[0]} expansion. * `set -i' is no longer valid, as in other shells. * BASH_SUBSHELL is now updated for process substitution and group commands in pipelines, and is available with the same value when running any exit trap. * Bash now checks $INSIDE_EMACS as well as $EMACS when deciding whether or not bash is being run in a GNU Emacs shell window. * Bash now treats SIGINT received when running a non-builtin command in a loop the way it has traditionally treated running a builtin command: running any trap handler and breaking out of the loop. * New variable: EXECIGNORE; a colon-separate list of patterns that will cause matching filenames to be ignored when searching for commands. * Aliases whose value ends in a shell metacharacter now expand in a way to allow them to be `pasted' to the next token, which can potentially change the meaning of a command (e.g., turning `&' into `&&'). * `make install' now installs the example loadable builtins and a set of bash headers to use when developing new loadable builtins. * `enable -f' now attempts to call functions named BUILTIN_builtin_load when loading BUILTIN, and BUILTIN_builtin_unload when deleting it. This allows loadable builtins to run initialization and cleanup code. * There is a new BASH_LOADABLES_PATH variable containing a list of directories where the `enable -f' command looks for shared objects containing loadable builtins. * The `complete_fullquote' option to `shopt' changes filename completion to quote all shell metacharacters in filenames and directory names. * The `kill' builtin now has a `-L' option, equivalent to `-l', for compatibility with Linux standalone versions of kill. * BASH_COMPAT and FUNCNEST can be inherited and set from the shell's initial environment. * inherit_errexit: a new `shopt' option that, when set, causes command substitutions to inherit the -e option. By default, those subshells disable - e. It's enabled as part of turning on posix mode. * New prompt string: PS0. Expanded and displayed by interactive shells after reading a complete command but before executing it. * Interactive shells now behave as if SIGTSTP/SIGTTIN/SIGTTOU are set to SIG_DFL when the shell is started, so they are set to SIG_DFL in child processes. * Posix-mode shells now allow double quotes to quote the history expansion character. * OLDPWD can be inherited from the environment if it names a directory. * Shells running as root no longer inherit PS4 from the environment, closing a security hole involving PS4 expansion performing command substitution. * If executing an implicit `cd' when the `autocd' option is set, bash will now invoke a function named `cd' if one exists before executing the `cd' builtin. - Update to readline library 7.0 release candidate 1 * The history truncation code now uses the same error recovery mechansim as the history writing code, and restores the old version of the history file on error. The error recovery mechanism handles symlinked history files. * There is a new bindable variable, `enable-bracketed-paste', which enables support for a terminal's bracketed paste mode. * The editing mode indicators can now be strings and are user-settable (new `emacs-mode-string', `vi-cmd-mode-string' and `vi-ins-mode-string' variables). Mode strings can contain invisible character sequences. Setting mode strings to null strings restores the defaults. * Prompt expansion adds the mode string to the last line of a multi-line prompt (one with embedded newlines). * There is a new bindable variable, `colored-completion-prefix', which, if set, causes the common prefix of a set of possible completions to be displayed in color. * There is a new bindable command `vi-yank-pop', a vi-mode version of emacs- mode yank-pop. * The redisplay code underwent several efficiency improvements for multibyte locales. * The insert-char function attempts to batch-insert all pending typeahead that maps to self-insert, as long as it is coming from the terminal. * rl_callback_sigcleanup: a new application function that can clean up and unset any state set by readline's callback mode. Intended to be used after a signal. * If an incremental search string has its last character removed with DEL, the resulting empty search string no longer matches the previous line. * If readline reads a history file that begins with `#' (or the value of the history comment character) and has enabled history timestamps, the history entries are assumed to be delimited by timestamps. This allows multi-line history entries. * Readline now throws an error if it parses a key binding without a terminating `:' or whitespace. - Remove patches which are upstream solved bash-3.2-longjmp.dif bash-4.3-headers.dif readline-6.1-wrap.patch - Rename patches bash-4.3.dif become bash-4.4.dif readline-6.3.dif become readline-7.0.dif - Refresh other patches as well- Define the USE_MKTEMP and USE_MKSTEMP cpp macros as the implementation is already there. - Add patch bash-4.3-pathtemp.patch to allow root to clear the file systems. Otherwise the completion does not work if /tmp if full (ENOSPC for here documents)- Remove --hash-size options as there is no any change in the final binary nor library anymore- Add upstream patch bash43-039 Using the output of `declare -p' when run in a function can result in variables that are invisible to `declare -p'. This problem occurs when an assignment builtin such as `declare' receives a quoted compound array assignment as one of its arguments. - Add upstream patch bash43-040 There is a memory leak that occurs when bash expands an array reference on the rhs of an assignment statement. - Add upstream patch bash43-041 There are several out-of-bounds read errors that occur when completing command lines where assignment statements appear before the command name. The first two appear only when programmable completion is enabled; the last one only happens when listing possible completions. - Add upstream patch bash43-042 There is a problem when parsing command substitutions containing `case' commands within pipelines that causes the parser to not correctly identify the end of the command substitution.- add bash-4.3-perl522.patch to fix texi2html for perl 5.22 (defined(@array) has been deprecated since at least 2012)- Add upstream patch bash43-034 If neither the -f nor -v options is supplied to unset, and a name argument is found to be a function and unset, subsequent name arguments are not treated as variables before attempting to unset a function by that name. - Add upstream patch bash43-035 A locale with a long name can trigger a buffer overflow and core dump. This applies on systems that do not have locale_charset in libc, are not using GNU libiconv, and are not using the libintl that ships with bash in lib/intl. - Add upstream patch bash43-036 When evaluating and setting integer variables, and the assignment fails to create a variable (for example, when performing an operation on an array variable with an invalid subscript), bash attempts to dereference a null pointer, causing a segmentation violation. - Add upstream patch bash43-037 If an associative array uses `@' or `*' as a subscript, `declare -p' produces output that cannot be reused as input. - Add upstream patch bash43-038 There are a number of instances where `time' is not recognized as a reserved word when the shell grammar says it should be.- move info deletion to %preun sections- bash-4.3-loadables.dif: One more warning fixed, in examples/loadables/logname.c. - bash-4.3-loadables.dif: Reverted one warning fix, which was introducing another warning and possibly a bug.- bash-4.3-loadables.dif: Split changes to shell.h to a separate patch "bash-4.3-include-unistd.dif", as the loadables build just fine without these changes. - bash-4.3-loadables.dif: Drop all header file inclusion fixups, upstream fixed the problem differently 5 years ago.- Do not restart all signal handlers for bash 4.3 as this breaks trap handler in subshells waotiug for a process- Remove -DMUST_UNBLOCK_CHLD(=1) as this breaks waitchild(2) on linux- Add upstream patch bash43-031 The new nameref assignment functionality introduced in bash-4.3 did not perform enough validation on the variable value and would create variables with invalid names. - Add upstream patch bash43-032 When bash is running in Posix mode, it allows signals -- including SIGCHLD -- to interrupt the `wait' builtin, as Posix requires. However, the interrupt causes bash to not run a SIGCHLD trap for all exited children. This patch fixes the issue and restores the documented behavior in Posix mode. - Add upstream patch bash43-033 Bash does not clean up the terminal state in all cases where bash or readline modifies it and bash is subsequently terminated by a fatal signal. This happens when the `read' builtin modifies the terminal settings, both when readline is active and when it is not. It occurs most often when a script installs a trap that exits on a signal without re-sending the signal to itself.- Fix the sed command that fixes up the patch headers. It was printing a duplicate header line, which suprisingly did not confuse patch, but could in the future. - Fix all patches that had the duplicate header line issue.- Use tail command to follow run-tests instead of a simpe cat command- Really remove obsolete patches- Skip autoconf on OS 10.2 or older- Avoid fdupes on SLES-10- Bump bash version to 4.3- Allow building on targets from SL 10.1 to current since it's free- Add upstream patches bash43-030 which fixes CVE-2014-6278 bash43-029 which fixes CVE-2014-6277 bash43-028 which fixes CVE-2014-7186/CVE-2014-7187- Add patch bash-4.2-extra-import-func.patch which is based on the BSD patch of Christos. As further enhancements the option import-functions is mentioned in the manual page and a shopt switch is added to enable and disable import-functions on the fly - Rename bash-4.2-extra-import-func.patch to bash-4.3-extra-import-func.patch- Add upstream patches bash43-027 which fixed bsc#898604 bash43-026 which fixes CVE-2014-7169 and bsc#898346 bash43-025 which replaces bash-4.3-CVE-2014-6271.patch and fixes bnc#896776 - Remove patch bash-4.3-CVE-2014-6271.patch due patch bash43-027 - Add patch bash-4.2-CVE-2014-7187.patch for bsc#898603, CVE-2014-7186, CVE-2014-7187: bad handling of HERE documents and for loop issue- Use a version linker script for libreadline 6.3 as there are new symbols in this 6.3 version like the rl_executing_keyseq and those are used by the new bash 4.3- Add bash-4.3-CVE-2014-6271.patch to fix CVE-2014-6271, the unexpected code execution with environment variables (bnc#896776)- Update to bash 4.3 with patch level 24 * The -t timeout option to `read' does not work when the -e option is used * When PS2 contains a command substitution, here-documents entered in an interactive shell can sometimes cause a segmentation fault. * When the readline `revert-all-at-newline' option is set, pressing newline when the current line is one retrieved from history results in a double free and a segmentation fault. * Using nested pipelines within loops with the `lastpipe' option set can result in a segmentation fault. * Bash does not correctly parse process substitution constructs that contain unbalanced parentheses as part of the contained command. * Indirect variable references do not work correctly if the reference variable expands to an array reference using a subscript other than 0- Don't use outdated C standard- Update to bash 4.3 with patch level 18 * When a SIGCHLD trap runs a command containing a shell builtin while a script is running `wait' to wait for all running children to complete, the SIGCHLD trap will not be run once for each child that terminates. * Using reverse-i-search when horizontal scrolling is enabled doe not redisplay the entire line containing the successful search results. * Under certain circumstances, $@ is expanded incorrectly in contexts where word splitting is not performed. * When completing directory names, the directory name is dequoted twice. This causes problems for directories with single and double quotes in their names. * An extended glob pattern containing a slash (`/') causes the globbing code to misinterpret it as a directory separator. * The code that creates local variables should not clear the `invisible' attribute when returning an existing local variable. Let the code that actually assigns a value clear it. * When assigning an array variable using the compound assignment syntax, but using `declare' with the rhs of the compound assignment quoted, the shell did not mark the variable as visible after successfully performing the assignment. - Update to readline library 6.3 with patch level 6 * Using reverse-i-search when horizontal scrolling is enabled does not redisplay the entire line containing the successful search results. - Remove readline-horizontal-redisplay.patch as now upstream - Rename readline-6.2.dif to readline-6.3.dif and bash-4.2.dif to bash-4.3.dif- Add readline-horizontal-redisplay.patch from upstream as a temporary fix for failing incremental search in horizontal-scroll-mode- Make patch command work on older products- Update to bash 4.3 with patch level 11 * The `helptopic' completion action now maps to all the help topics, not just the shell builtins. * The `help' builtin no longer does prefix substring matching first, so `help read' does not match `readonly', but will do it if exact string matching fails. * The shell can be compiled to not display a message about processes that terminate due to SIGTERM. * Non-interactive shells now react to the setting of checkwinsize and set LINES and COLUMNS after a foreground job exits. * There is a new shell option, `globasciiranges', which, when set to on, forces globbing range comparisons to use character ordering as if they were run in the C locale. * There is a new shell option, `direxpand', which makes filename completion expand variables in directory names in the way bash-4.1 did. * In Posix mode, the `command' builtin does not change whether or not a builtin it shadows is treated as an assignment builtin. * The `return' and `exit' builtins accept negative exit status arguments. * The word completion code checks whether or not a filename containing a shell variable expands to a directory name and appends `/' to the word as appropriate. The same code expands shell variables in command names when performing command completion. * In Posix mode, it is now an error to attempt to define a shell function with the same name as a Posix special builtin. * When compiled for strict Posix conformance, history expansion is disabled by default. * The history expansion character (!) does not cause history expansion when followed by the closing quote in a double-quoted string. * `complete' and its siblings compgen/compopt now takes a new `-o noquote' option to inhibit quoting of the completions. * Setting HISTSIZE to a value less than zero causes the history list to be unlimited (setting it 0 zero disables the history list). * Setting HISTFILESIZE to a value less than zero causes the history file size to be unlimited (setting it to 0 causes the history file to be truncated to zero size). * The `read' builtin now skips NUL bytes in the input. * There is a new `bind -X' option to print all key sequences bound to Unix commands. * When in Posix mode, `read' is interruptible by a trapped signal. After running the trap handler, read returns 128+signal and throws away any partially-read input. * The command completion code skips whitespace and assignment statements before looking for the command name word to be completed. * The build process has a new mechanism for constructing separate help files that better reflects the current set of compilation options. * The -nt and -ot options to test now work with files with nanosecond timestamp resolution. * The shell saves the command history in any shell for which history is enabled and HISTFILE is set, not just interactive shells. * The shell has `nameref' variables and new -n(/+n) options to declare and unset to use them, and a `test -R' option to test for them. * The shell now allows assigning, referencing, and unsetting elements of indexed arrays using negative subscripts (a[-1]=2, echo ${a[-1]}) which count back from the last element of the array. * The {x})- Add bash-4.2-strcpy.patch from upstream mailing list to patch collection tar ball to avoid when using \w in the prompt and changing the directory outside of HOME the a strcpy work on overlapping memory areas.- add a conflict between readline5 and readline6-32bit- Do not restart the sighandler after a trap is reset (bnc#820149)- Add patch from upstream mailing list to speed up array handling - Add patch from upstream mailing list to avoid fdleaks - Use lsdiff to determine the depth of the leading slashes in a patch file- Disable workaround for bnc#382214 due bnc#806628, let's see when the old bug will be up again. - Update bash 4.2 to patch level 45 * When SIGCHLD is trapped, and a SIGCHLD trap handler runs when a pending `read -t' invocation times out and generates SIGALRM, bash can crash with a segmentation fault. * When converting a multibyte string to a wide character string as part of pattern matching, bash does not handle the end of the string correctly, causing the search for the NUL to go beyond the end of the string and reference random memory. Depending on the contents of that memory, bash can produce errors or crash. * The <&n- and >&n- redirections, which move one file descriptor to another, leave the file descriptor closed when applied to builtins or compound commands. - Use screen to provide a controlling terminal for running the test suite- config-guess-sub-update.patch: Update config.guess/sub for aarch64 - Fix check for negated warning switch- Avoid autoconf on older products - Apply audit patch variant to readline as well as we use a shared libreadline - Avoid bash-devel on older products as older GNU make do not have a realpath builtin- Do not trigger the export of COLUMNS or LINES due enforced checkwinsize (bnc#793536)- Update bash 4.2 to patch level 42 * Missing I/O errors if output redirection applied to builtin commands when the file descriptor was closed * Process substitution incorrectly inherited a flag that inhibited using the temporary environment for variable lookups if it was providing the filename to a redirection. * Compilation failed after specifying the `minimal config' option- Update bash 4.2 to patch level 39 * Official fix for the last crash fix * Avoid variable expansion in arithmetic expressions when evaluation is being suppressed- Do not mix xmalloc/xfree of libreadline and bash by making the libreadline version weak symbols instead of private symbols- Add patch from upstream mailing list to avoids crash- Update bash 4.2 to patch level 37 * Attempting to redo (using `.') the vi editing mode `cc', `dd', or `yy' commands leads to an infinite loop.- Do not mask internal _rl symbols as internal as there are many tools out there which uses them (gdb as an example)- libreadlib: try to avoid to bind references of the symbols rl_instream and rl_outstream - libreadlib: make private symbols really private- Increase buffer for libreadline messsages if required - Include stdio.h in libreadline header files to get the declaration of FILES correct.- Update bash 4.2 to patch level 36 * Patch 25: When used in a shell function, `declare -g -a array=(compound assignment)' creates a local variable instead of a global one. * Patch 26: The `lastpipe' option does not behave correctly on machines where the open file limit is less than 256. * Patch 27: When the `extglob' shell option is enabled, pattern substitution does not work correctly in the presence of multibyte characters. * Patch 28: When using a word expansion for which the right hand side is evaluated, certain expansions of quoted null strings include spurious ^? characters. * Patch 29: Bash-4.2 tries to leave completed directory names as the user typed them, without expanding them to a full pathname. One effect of this is that shell variables used in pathnames being completed (e.g., $HOME) are left unchanged, but the `$' is quoted by readline because it is a special character to the shell. * Patch 30: When attempting to glob strings in a multibyte locale, and those strings contain invalid multibyte characters that cause mbsnrtowcs to return 0, the globbing code loops infinitely. * Patch 31: A change between bash-4.1 and bash-4.2 to prevent the readline input hook from being called too frequently had the side effect of causing delays when reading pasted input on systems such as Mac OS X. This patch fixes those delays while retaining the bash-4.2 behavior. * Patch 32: Bash-4.2 has problems with DEL characters in the expanded value of variables used in the same quoted string as variables that expand to nothing. * Patch 33: Bash uses a static buffer when expanding the /dev/fd prefix for the test and conditional commands, among other uses, when it should use a dynamic buffer to avoid buffer overflow. * Patch 34: In bash-4.2, the history code would inappropriately add a semicolon to multi-line compound array assignments when adding them to the history. * Patch 35: When given a number of lines to read, `mapfile -n lines' reads one too many. * Patch 36: Bash-4.2 produces incorrect word splitting results when expanding double-quoted $@ in the same string as and adjacent to other variable expansions. The $@ should be split, the other expansions should not. - Add patch to avoid double free or corruption due expanding number sequence with huge numbers. Patch will go upstream (bnc#763591)- license update: GPL-3.0+ Upstream declares the bash license to be GPL-3.0+ - not GPL-2.0+- Enable auditing patch by simply applying it- added auditing patch from http://git.savannah.gnu.org/cgit/bash.git/plain/CWRU/audit-patch- Remove not required patch (was a fix for bnc#141394) which now cause a wrong behaviour if applied (bnc#755453)- Update bash 4.2 to patch level 24- Avoid endless loop in user completion caused by endpw patches- Add small patch for be able to use nanoseconds in comparision of time stamps of files (bnc#750640)- Reenable patch for bnc#725657 with latest change from latest git repository of the patch.- add autoconf as buildrequire to avoid implicit dependency- remove suse_update_config calls - obsolete- Make build check quiet- Update bash 4.2 to patch level 20 - Update readline 6.2 to patch level 2- Disable endpwent() in rl_username_completion_function() as this cause a deadlock in a futex of the glibc (bnc#731556)- Enforce bind references to global function symbols to the definition within libreadline- Use libtinfo if available otherwise libncurses, this avoids linkage against libncursesw of libreadline (required due bnc #729226)- Avoid memory mapped /var/run/nscd/passwd at shutdown by simply unmapping this only used area if parent is systemd or SysVinit- Always close get(pw|gr)func with endpw() respectivly with endgr() to avoid memory mapped passwd/groups of cache files from nscd- Disable last patch as it seems a bit broken (bnc#725657)- Add direxpand patch from upstream (bnc#725657)- Add patch from upstream mailing list to avoid memory leak by reassigning associative array variable- remove autoreqprov and author lists- Add fix from upstream mailing list to avoid crash- use original source URLs- Fix the fix for bug bnc#681286 to be able to avoid both a not expanding glob as well as the infinit loop in multi byte locale- Update bash 4.2 to patch level 10 - Add patch from upstream to avoid loosing quoted-nulls - Add modified patch to avod endless loop in UTF-8 locale- Remove patch to avod endless loop in UTF-8 locale as it breaks glob expanding (bnc#681286)- Update bash 4.2 to patch level 8 - Add Ctr-C patch from upstream - Add fix for endless loop in UTF-8 locale- Avoid siglongjmp, compare with http://lists.gnu.org/archive/html/bug-bash/2011-03/msg00070.html use temprary solution from Chet- Much better solution for saving history for system with sigsetjmp- Reintroduce history saving at SIGHUP- Update bash 4.2 to patch level 7- having a bash man page is recommended (bnc#672528)- Update to bash 4.2 -- changelog see entry for bash 4.2 rc1- Update to bash 4.2 rc1 * `exec -a foo' now sets $0 to `foo' in an executable shell script without a leading #!. * Subshells begun to execute command substitutions or run shell functions or builtins in subshells do not reset trap strings until a new trap is specified. This allows $(trap) to display the caller's traps and the trap strings to persist until a new trap is set. * `trap -p' will now show signals ignored at shell startup, though their disposition still cannot be modified. * $'...', echo, and printf understand \uXXXX and \UXXXXXXXX escape sequences. * declare/typeset has a new `-g' option, which creates variables in the global scope even when run in a shell function. * test/[/[[ have a new -v variable unary operator, which returns success if `variable' has been set. * Posix parsing changes to allow `! time command' and multiple consecutive instances of `!' (which toggle) and `time' (which have no cumulative effect). * Posix change to allow `time' as a command by itself to print the elapsed user, system, and real times for the shell and its children. * $((...)) is always parsed as an arithmetic expansion first, instead of as a potential nested command substitution, as Posix requires. * A new FUNCNEST variable to allow the user to control the maximum shell function nesting (recursive execution) level. * The mapfile builtin now supplies a third argument to the callback command: the line about to be assigned to the supplied array index. * The printf builtin has a new %(fmt)T specifier, which allows time values to use strftime-like formatting. * There is a new `compat41' shell option. * The cd builtin has a new Posix-mandated `-e' option. * Negative subscripts to indexed arrays, previously errors, now are treated as offsets from the maximum assigned index + 1. * Negative length specifications in the ${var:offset:length} expansion, previously errors, are now treated as offsets from the end of the variable. * Parsing change to allow `time -p --'. * Posix-mode parsing change to not recognize `time' as a keyword if the following token begins with a `-'. This means no more Posix-mode `time -p'. Posix interpretation 267. * There is a new `lastpipe' shell option that runs the last command of a pipeline in the current shell context. The lastpipe option has no effect if job control is enabled. * History expansion no longer expands the `$!' variable expansion. * Posix mode shells no longer exit if a variable assignment error occurs with an assignment preceding a command that is not a special builtin. * History expansion no longer expands the `$!' variable expansion. * Posix mode shells no longer exit if a variable assignment error occurs with an assignment preceding a command that is not a special builtin. * Non-interactive mode shells exit if -u is enabled and an attempt is made to use an unset variable with the % or # expansions, the `//', `^', or `,' expansions, or the parameter length expansion. * Posix-mode shells use the argument passed to `.' as-is if a $PATH search fails, effectively searching the current directory. Posix-2008 change. - Update to readline 6.2 rc1 * The history library does not try to write the history filename in the current directory if $HOME is unset. This closes a potential security problem if the application does not specify a history filename. * New bindable variable `completion-display-width' to set the number of columns used when displaying completions. * New bindable variable `completion-case-map' to cause case-insensitive completion to treat `-' and `_' as identical. * There are new bindable vi-mode command names to avoid readline's case- insensitive matching not allowing them to be bound separately. * New bindable variable `menu-complete-display-prefix' causes the menu completion code to display the common prefix of the possible completions before cycling through the list, instead of after.- fix czech message- Update bash 4.1 to patch level 9 * When declaring an associative array and implicitly assigning a value to element "0", bash does not correctly allocate memory, leading to a segmentation violation when that element or the array itself is unset. * An arriving SIGCHLD will interrupt `slow' system calls such as write(2) to or read(2) from a terminal. This results in an error message and truncated input or output.- builtin "man2html"generates html manual with a timestamp that causes the package to be published over and over again.- A modified version of the pipe patch which should handle the PIPESTATUS array- Disable the pipe patch from Thu Jun 24 10:40:09 CEST 2010 as this resets the PIPESTATUS array to the status of the forground process only- Add fix from mailing list to avoid crash- Comment out recommendation of bash-completion, as I'd like no to see the bugs of bash-completion in my bugzilla- Do not package static libraries - Fix Recommends/Suggests- Add fix from upstream: restore the parser state over changing readline editing mode otherwise e.g. set alias before the change are lost.- Avoid running the last member of a pipe command sequence to run in its own subshell, this makes know lines like the simple echo 1 2 | read a b; echo $a $b work as expected by the users- Update bash 4.1 to patch level 7 * Bash did not correctly print/reproduce here documents attached to commands inside compound commands such as for and while. * A typo caused bash to not honor a precision specification in a printf format.- Add fix for memory double free in array handling- Update bash 4.1 to patch level 5 (related to bnc#522351) * If command completion is attempted on a word with a quoted globbing character (e.g., `*' or `?'), bash can reference a NULL pointer and dump core. * When running in Posix mode and executing a shell function without local variables, bash will not propagate a variable in a special builtin's temporary environment to have global scope. * When the `read' builtin times out after the timeout specified with -t is exceeded, it does not reset the flags that tell signal handlers to process signals immediately instead of deferring their handling. This can result in unsafe functions being called from signal handlers, which can cause bash to hang or dump core.- Add patch from bash-bug list to avoid crahs on some strange TAB completions- fix warning no return statement in function returning non-void to fix build (in bashline.c)- Avoid hang due malloc()/free() within signal handler (bnc#522351)- Add patch to reflect the usage of /etc/bash.bashrc (bnc#577221)- Update bash 4.1 to patch level 2 * Here-documents within $(...) command substitutions may once more be delimited by the closing right paren, instead of requiring a newline. * Bash's file status checks (executable, readable, etc.) now take file system ACLs into account on file systems that support them. * Bash now passes environment variables with names that are not valid shell variable names through into the environment passed to child processes. * The `execute-unix-command' readline function now attempts to clear and reuse the current line rather than move to a new one after the command executes. * `printf -v' can now assign values to array indices. * New `complete -E' and `compopt -E' options that work on the "empty" completion: completion attempted on an empty command line. * New complete/compgen/compopt -D option to define a `default' completion: a completion to be invoked on command for which no completion has been defined. If this function returns 124, programmable completion is attempted again, allowing a user to dynamically build a set of completions as completion is attempted by having the default completion function install individual completion functions each time it is invoked. * When displaying associative arrays, subscripts are now quoted. * Changes to dabbrev-expand to make it more `emacs-like': no space appended after matches, completions are not sorted, and most recent history entries are presented first. * The [[ and (( commands are now subject to the setting of `set -e' and the ERR trap. * The source/. builtin now removes NUL bytes from the file before attempting to parse commands. * There is a new configuration option (in config-top.h) that forces bash to forward all history entries to syslog. * A new variable $BASHOPTS to export shell options settable using `shopt' to child processes. * There is a new confgure option that forces the extglob option to be enabled by default. * New variable $BASH_XTRACEFD; when set to an integer bash will write xtrace output to that file descriptor. * If the optional left-hand-side of a redirection is of the form {var}, the shell assigns the file descriptor used to $var or uses $var as the file descriptor to move or close, depending on the redirection operator. * The < and > operators to the [[ conditional command now do string comparison according to the current locale if the compatibility level is greater than 40. * Programmable completion now uses the completion for `b' instead of `a' when completion is attempted on a line like: a $(b c. * Force extglob on temporarily when parsing the pattern argument to the == and != operators to the [[ command, for compatibility. * Changed the behavior of interrupting the wait builtin when a SIGCHLD is received and a trap on SIGCHLD is set to be Posix-mode only. * The read builtin has a new `-N nchars' option, which reads exactly NCHARS characters, ignoring delimiters like newline. * The mapfile/readarray builtin no longer stores the commands it invokes via callbacks in the history list. * There is a new `compat40' shopt option. - Update readline 6.1 to patch level 1 * New bindable function: menu-complete-backward. * In the vi insertion keymap, C-n is now bound to menu-complete by default, and C-p to menu-complete-backward. * When in vi command mode, repeatedly hitting ESC now does nothing, even when ESC introduces a bound key sequence. This is closer to how historical vi behaves. * New bindable function: skip-csi-sequence. Can be used as a default to consume key sequences generated by keys like Home and End without having to bind all keys. * New application-settable function: rl_filename_rewrite_hook. Can be used to rewite or modify filenames read from the file system before they are compared to the word to be completed. * New bindable variable: skip-completed-text, active when completing in the middle of a word. If enabled, it means that characters in the completion that match characters in the remainder of the word are "skipped" rather than inserted into the line. * The pre-readline-6.0 version of menu completion is available as "old-menu-complete" for users who do not like the readline-6.0 version. * New bindable variable: echo-control-characters. If enabled, and the tty ECHOCTL bit is set, controls the echoing of characters corresponding to keyboard-generated signals. * New bindable variable: enable-meta-key. Controls whether or not readline sends the smm/rmm sequences if the terminal indicates it has a meta key that enables eight-bit characters.- package documentation as noarch- add baselibs.conf as a source- Fix bug in bash-4.0-security.patch (bnc#559877)- Update to newest patch level 35 * bash incorrectly interprets wildcarded path components between a **/ and the last / * bash incorrectly treated single and double quotes as delimiters rather than introducing quoted strings when splitting the line into words for programmable completion functions- Make _rl_enable_meta configurable by the users (bnc#541379)- Do not change tty owner group twice by child and parent (bnc#523667)- Update to newest patch level 33 * Includes one of our own patches- rediff patches to avoid fuzz- Update to newest patch level 28- Add fix from bash maintainer for closing memory leak in read builtin (bnc#510288)- Branch off some sub packages: * bash-lang to include localization * bash-loadables for installing the loadable runtime builtins * bash-devel to install headers for developing loadable builtins- Enforce the usage of euidaccess(3) instead of stat(2) for testing permissions for a file (bnc#509105)- Update to newest patch level 24: * include last few patches - Add patches from mailing list for globstar expansion- Increase size of hash table for runtime linker a lot- Add patches from mailing list: * fix problem with invisible characters in prompt * make dir*/** work- Do not crash on forbidden subdirectories with globstar extension- Add fix to be able to clear to eol in readline library- Add fix for timing issue in readline SIGWINCH handling- Add patches from bug-bash@gnu.org to avoid eg. segmentation fault- Add patches from bug-bash@gnu.org to avoid eg. segmentation fault- Add patch from bug-bash@gnu.org to enable |& not only for builtins and shell functions but for all commands.- Switch to official patches, now we are on patch level 10- Use patches from bug-bash@gnu.org to make it work- Patch for bnc#481817 does not work in any case- My last patch for bnc#470548 send to bug-bash@gnu.org was not fully applied and this had caused a memory corruption on tab completion. - Enable the parser to find closing parenthesis at the end of an argument of a command even if backslash is used (bnc#481817) - Correct link of shared libraries of devel readline packagecloud124 1539073100 4.4-lp150.8.3.14.4-lp150.8.3.1bashMakefile.incbasenamedirnamefinfoheadidlnlognamemkdirmypidpathchkprintprintenvpushrealpathrmdirsetpgidsleepstrftimesyncteetruefalsettyunameunlinkwhoami/lib64//lib64/bash/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Maintenance:8893/openSUSE_Leap_15.0_Update/39ef79426dc57316a8eccc39b147c6db-bash.openSUSE_Leap_15.0_Updatecpioxz5x86_64-suse-linux directorymakefile script, ASCII text, with very long linesELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=36a74a857759ff8ce921042f651209f64a0568f5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=618714543a2557749c16da913193c3a32a3c16d7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4e2acc0ad1d74255d2fff1704eba812a2d03bc1d, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6dd823b6faad775172af37005a40ae0aa08f1609, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=2482e8e34bd4127564ab1696daa8242b3d8f801c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=41f06744c6b2031f7fa84b7becb4a45bfff31885, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f2527bed8fdb4acf28a1b2250ddafbebdc940f8e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=23efe200e59e8fcad4dc42d695048d1cb9a82718, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0883ceeb73d1f5d4ec2b51b9a15e0333893a632a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f41061ba06c02c9043b2d4dc3e2221cdb820a178, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1ee0c9f28f5b781963593e10d0c4b3f28353f9d4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=73e07ac895025159209f7adf97766e166e71ad85, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=034b72c06069aabf6a7895b8733d19839e93c057, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3ed05aea1aba117cce1f0ecfdd38a170e07fc4da, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d24239007377ea3cddc86a8b078aa8cf7e07bcb1, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8fd986576944f861aa89bc0fc0f6c3934b25d040, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4a8f5afc6e40abd08c10e6eaefb965398bbf34b9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a004eb98c335d9bfbe020779ce8668e3c232c87f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cb9ec82e4c7600c8598c0ca1603d72e7706a47fd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=99f4aa523511ba7c48a4e850863fca9ff25efe72, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e90219d94504faddb12b755288d551acbcf3af72, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=583b3e3abf9485f9da74f4f71eb95754b2c6dcf0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=1af2918b70f265b4146e7257b979544f8044a33c, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f864e284ff63b546a090c5ef83a2efd3a2f0f815, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=292c375ee7fd2fa807d1315cd1d6d6d3e3daee00, stripped !#'),/2468:>@RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRg+w:MMutf-86e7ca8ac370abf12589cf73d9ca37794af1bebeabc2da975df0c0871c8bc3669? 7zXZ !t/gt] crt:bLL F-'W+L+c8w :ܨK!M^csr3r\~N;ZI "HbN㻏l\_yYh-| w,L@; {Ѹ2G{HB~j/(:)&\KK2a~Sw9J@&C_OyWby >0fpůSE'`[0nq8`sP)r]wsCܹm =W47 \$jzV6&o*uQ:lr(;K^fEۊ/"+֎dJ`nc[ͬ\MtV5㼝ZM:=>zZ=+u hV-ch)y Rr x]Xr̞_na2$YP% }uG"m-]ͥr5™q6*0_Hf2' Sbpƣi9OqI7- iqТ/5h l90LA1  "I0[B3jj  vyi%j@ zPn|⏽]YNZ2e#z8v梺!v3oQXpA XL=i~y/]/@7ezMy$Tދ<)GP)""5q~ ǖ;8f t=򮊦܃+;*KX1KyjKx{YlR=hϽb٧jf M,y%;#x(DN߇'Z̈|y]/qvW-CBGK- 6}L(K>$ZXϬ{|y9Klpތ$ӛ矃'(GXHteG6cnBr/l@kwdU-$OI^I׉mÆȡXhʋɵs\UOGEkv^wty\C,q@McWFa0\hQ#:C_<L#nTg (X"ڽwե S.Tހ20yB?l ^"3+=vI {rE3EOmp^|bfw2 1{ ߫[I04`(n%E;ǁz@1L;^qc(y}*wQ @>zҖV{2~"V'"M4F N)88_ ! GHiN~Q%D3Y񇭙U5q=1!#W0{l}v`J[{t7Ee=Nyk,Er8UMqpraeev/gEZئ(2`2e渳7 p*j#v][$QDPn!( Î!k__A].Qvr!yӲ%5#kY>˭V]^ݻctoBr6BC'\)b"XN8}X';rʂVH..B+]4Ÿ\6)qW=Bk|(j.,]3NE|W؎ p)rF$ ,qH0EaȖY+(K6Qsyn.6$pUn> <#qg7!FiBykwP;\xEݛߣLơE~%;:S{v1P<$*GFҢ׮mƑ~KK4Z5Lk5uU9%03!fC]U|hR&+[[^^bѽǾhBbdL)_}EfhI5zvqXI>2Ylcá@kP0m†{{$v6w Vkm&AN'= moΕh+R܂蝹#b[rAS͌UQG bw{6lɣtaF{)D$gTG82!DDnx5Jvu/YyGH;nb4ibԜii$`hf퉫N弑O%z,5*Ԙ@4IYֹ<ԚlyCkbC(>}nKWZr{BXYh134>Fw!eq QM 1De e6C|uW%:"EF(44%*>({4gyn`:dRo?F6FFEDŽ01'3.~2swfaiʯEfVOSOwxGhqֶgT3ǣMfLS%oS `?~|Pk`W.wx m%itRGj1%1Mnx+EW>sMkݾY23H$f!c\(bBkiMӫ NJwH+zAM4I ,z t/KVdƵM5Y=^sjױViᨈ p;Tu4^.+CKMDyyEWнiX$ĠMtp~oB*l 9GvV/җ$l!Ce菢q̱!Ϙ%eaY1h.5adߠ.K 313aȘڽLjn# П/4|f=VN&EfG 9ndSz{kOVh\;h]EO뛋 k{,K7he5 8^,χL&}thnP#NMXY$^o%p蝊#+,9"rm9/LZ+Pf&K)|N(^˧PC?%9b1F%;_EM)"TݮZ ;,tخєM;|Nր̴#.PԠLlM`CZou(XB6"sn|~h_T'0+1wzhGima3Uyf;!gi7=Mn>VQJ"#\m%?2#7Ƙ"A=4 Ph>0\*`cغp2 LVvLPg/.ψАE`'YdU+F*J@]5qIA1r X5]2鋹$SGO'lWOezk\!TeFft?.[O?S8`0%|ePsO z:tTYc8UMu|01t[w2XG )ՂqZ=<> 4jy΋@(Y:vʻ8H l#¡>]q-k>ݥa\~-$6#!>Kȣ@H-%xgٻ̴;[Y y{X1EdwDV&m9sM:҇KJbgͪEwq(旌7֑^h=T lJ yn霍ʛLS_]j&㋂*BK6Wեប 2Y*.E@`RhuqՂ-{c{)AØJ_TM$>~^6Tťc0B.5~7Xvlgq,+ xd}fKtuoB͌l2nǔ?vs.L13phvV_lO##w/8l‰s5XSHs{31qU;Z`Qd%1?q p]4Qm4 ڰb\p.W[ݹ\p]φNd mx#&ܮmId]47yӫZ2`( ޹Ǒqlʘý#l ,*eW݀fȐWi;^:>Bp<] u ZDb|-}mC鸦i0^'>ɏBo92PsRxeqEb2 wDG#|6qh揽P"AjB&!/~Og& ~1ZtjݪOV~򺣣\ Z!s¬:{Kk)zkK5#A\ k~kὍ8:dlAo؊P;Iܘ/6|}IX66]3U.YMһ ;6)쉝))lE% 7. [wL}'N[ vI$t){PPvFLئ#lI8[)h FnblB=hi1$"y 085P'n\)Fԣ^(ϟsr;aV91C)__8/PO{;]If4ө˨) 5xytא]]@l$S^y:Pw"UpPNEI}r$ȅ f $UyZzǃa=~FlMg ϠW)Xčr$̆ (>VBDU)Xǻ|B>,zwVb7NX|h@C~)zC0 c=e@ykITii!OYg~E1=oH:v91X' W0kiS)oukarI5lv]!:~wƘO2P+m 'ܞeKS+{l$co8 xGl>z_ukC<ǎnqe[w፾XSIAWسN$ð"J"V렵-&{DөlG!իo9vzǵI ?^MVwٴCO*!ƀMYy_t+0Bc,YPKhz4TbN,ҞxDF$sO- K@xr\'_rpzf@/ɛ S|f LjWc+&٧q ~@ QDw u A 5!Pa<Ұ{ûMX#lL}k֌Jtե[ nZtcq6+W~ς^GJN:C7shl  W> ­ZdbФx~řJal M9(tvfC!z9?J_ҡ$~<&U! ʌ$XU{, l<z {h/6 P,W_'i2'[wiE//řUZz 7E+X"R"uOTA6z%VIǒ Q Ƀ od9/+ 5 S$8{2 QDI]Tf G[A+ rv,||W=glG#G3g$p)O'`^'eeJJ ; ࡵߎfY3~;rEg?p5q u/DAX9+"+HYdh]TSq&jY fd1Sk@IL<(TKn6a+gib-7J A=&떓,yRo<,\YR"fQJVGIdFZ|cY g]6m~mVlj3e\/N ŗ|+mCC"ckڎv,k/ܙ$VQA_2.D j*?Ɏ'*lv*c=w?CC#\9!6An3'Y9Ik: RZRGȴ~"yt l PN41k",~ę?}79‘|K4scI3N7mm8}W3++aiߙŁ;t0'܅76ao:-uQ 6␢XJ= G*B@(iQёˡ2YUmT?kWuyu3栣$yޙcDPA2p'[D!Jl⼰0ΩvŅӣ2ȝyiGn,Q. I 4p$>[*fGyx F1pZ铆qhD8N W@jt!}]>Ӂwr,)=IfgsVI7E>*|vMfѬF0vD19C?a~z_.7U߇gEF&o]0&Dx) cʄz\!j m ~k!MVt2yq7\|QŧyBM^[w N>XO!iP0`z *8Cu5 o'ox z-.8`vQ6ig|VΓ =hݹm-1pOBY+J^:>C7*:L[ M8[p@9jԦ!Lh{>Y,Ȭx?+pĠMfQ49Gi415Sy~$0e=5^E*TdW!,l$7Q̋3EDp;c-rߟN脔`liY<\ TuPf67jg/7`~0}Q!l}1;Q5; Rs ؘBy2սQ{ <Wru[MN򫘘1d]վf_nu ˙e{T;⾒$m)<|ZW{&JjT"֪xPeh ҀX^ nQeB z-&K|Y:0 <(D_y=$R;DK`R+0gq;=7qo/X[\zf"Zc1:a:*^tPM J:hM"5`tbC67㡞G@VW9eq+!e2~ݵ1< wH<eH F, #zRמG9*~I6QAy^mMO@bSʯ=I:o-(B n쫦-QZ sP;`kشCr*&M&KLv-n]9j/*Sρt>Gڳq6\$4uU( vn9F,D |BrGIfP_87+`)[5`ʡV>0M9;զ5H`|`KminM;f&@?{$7Co; sjր9z$u8~,ðgWPZ'b3J9C}DzrvD"mY0o\EhN3|[`T˯2SʛDZZ=(COUߊT.,%пK,blʼnn6Þ0hQRRvP陛^UzVh}-@|>~B!bbL@ac6U4]襀bk?#̄L9"HE:G'4`xvl:Jad+Z~Tbar\h{˫Rw_Qh_Zx୏[j]"@CDѭ\O r BW_WQ3k ˋq A/B)ý@b& ԰xA)ױR䥉4쭥)S)+>ꗓF<܋ܕ 'j(᛬D u2ڃ"8@d=kU k" ) ?2}gf7"u'|☹ϽY" 3=~]xWVX|e{/ϵ}¼Զ';f5x]Q(9tJb"Xn1_A"+ô'P}i& ^6^luem*}dku5҃oOַKwXs:q;shj֧78S"f%"ec_Mh6̺}">1bqҤm5rXG(? ixHF5-%n롿Rhvo, &:1(7Gn ,bbHG ʊb9>V2[e/L EWH21a(i kDf $r#?q TR2]hŗɱG U$@ȭp$⡕1K*c;Ũ2^<HVqcϚ"u&8(@ķΡ(ɷ]vQM\)l`ֹ)J$IdvQD*Mq2zBaJ 1vc9wE?$9 ǁJ)Yp3Ɣ5bF2׻n"s#1vH~u_a궭d;tXU4Pwh]^Zh$bg'&zhQz:GT6\,.wX }AB5O<ީ(~"®uhx;o5T@X ;/.oX%$'HÐԧ \ ^8]er1Bq L(DO UÇa"E_[gϜkMM̎zi !s*2⿟Ȏn[xr;<If?9֜8?|JJA9.3.NczC MtMb4(z* M#i=L{|LCkTW\*]^v3BC1)w%ηO:y&fM̘W՛9#u٦۬EqzxŊɮe} w[R*l#eQ^Ҭ m.v&QStM>Y>I <,skju-?S=ߙ&XEjXcIX4ҡ+;Im8II^~0/&(HR[,S:S7?`e1 "0U;c섖B5UsEV½΢r?8A?gص)ŊD ~`?-WItcр ='@>#n1K6_WhuqY0o:4BQ?9!]{G'Xu<_R2*&@ ȪMBpkS-}):9++/"l q7WBTbPHQb?Dcm-*ʗ؝|i~Er^FUJTG{+_u;x- *2 a+4(2GKOoKtZ#mOt8s[GGO}p+(//>#qv8%M *Ғufr?sB(PW;$"t\7=a=X:tS &DbSċzM f"Emӝ䓈y% {X;1漮;5w6Fw%ۖP̴KA$5$X 8M4FjbF KWtj}A/&Rp"cn,0,X6S21sbԓjm⇬=R u5x~\8}wmҳ~t7[k az-7άI(TA#" gAf*ZbTn8Lbw4br>pb*5Mkx 8u~>D4 J80ko!d2i"Iq}6.# 2KqjpG[>p)åC3?A^]ݝB킇aJѩ=1/.HW5qKXc0&ԡ̲ KGY1j3?:NXeZB!F]JyJz |J13>1Jwc߆?@sGv4Mچ ʫ")&"({N:x0C޹/j~9PG7lS6xKrr70R^;M'O\voamG4E)w vGD>6S!%ؘ p5fEq>/tϺu'1tkeRHG3 tA6==Rd{;(ƅ{EG7Z9#dP˞- 듡VT?|(P =Oc XP([*|1 |,6x&?`t)"$7w`BU `_M![ BІ|K ^Ri`SUl{F0u HZ#63P߶AWܠI~(fp$!0J Kvk)>'(":;Dϭmu: z9 _T* Ԉ`Z1sBK[;NwO[QD E6)7_Tj̡c輫a%-&q7QB`y O U[W,;Sg񾷄e&Z C=_^WPk!LſB%mb+#l)骟c Y^(?ߜY).C G f5!{?VH\ѶrXsT4rC= x=3wGDu"X|;04-*k9[E~,TIiEHuf 6_\mg=kͩ֯2 M ^yfQ!ܚn ܊Ueٸ KsڒZɒ|@C-H`\lr˼x+a%I*P0d>ׅL'2b(&L]fTaj7|LpqBvwgY uy"_r$h&*eqj?צ eOb(A( Y`NO{i)V[etUɖg9eMmYۡ.0W\m</#Oe=~l>Y̛ YQ@_? 9B?E =j|g5!.% {|V ye4fo g*i-!G`#ӵsb.U,]ϳʸo.5':WCΞWI3l&cA8L <6ywp E;qz,28ZiAq{gO;l $˕[~E7!d!g%\kd8Տ=ND&EۈO3nYm0% {np/d_BǓ'dW;M[L+Br/,mM@w<&ܲl2(+gGV<ŷ𙙥мq!˔]<2"iuiڰ}\*wzg v1$KᆴTgӒ=)*F \20gBwLƒ@RYsphy dlnՔ{5)l`=,fZ%X=f*9bX-`]OrO|8;RRԅ*w83rjMk\5.@>)11.؄c, _Zü d1Ij}܋NyM(oT8OT0#9}ƠȜJ>fĸ_eu<y7_yW\ܱ//^l@H, *Y[SL!keL;Zؽ (Vv0r{e{l,:Pf^`Gr d@#[C/iVknA)Ti+~YU-}f]ƶ1W1/NN6D;DYiARb 2Obsʏ_E7' cNƉK]cfI@BmjCoLɝM}V_t};n$v{ռ4՘= `6Il IKdyF{)hzGHQ:1rY-)7}jpخd 7/u?9/,qlB`Xo-4$@A/9u, i#?Owl}A_=# }*#QNY(^6(@{/فwia~tr̜#pГ["QQG4qM7t4DU@+ҤV9΋ImbBPĥwt*p 9'DԈiqP b:=DȰ8Ybƣ!නy|>@Σ!|^ޮIEԃY<*j4IShdpMK(Zc+ȭ| rXOeoh  K;#,X|DgyS<x[2[)B<^n0aް8Vfnzs xΟ!+#epuۍ4M} R)Rj$ϏQ+'vjzm! ͉w^*{2 .k}"Mci}œIʹ(tk*/B  >Tn?<+Hnc`Bƻ8w3E{ywUGrH`#S7h*P,~z\~{X`o痋I6cz X*|̉.kFm_Um\Po "ۤ=)͵:g@c" eݘ]*b$[\c1N@"AWFp?w 4bwek-a85x+" >2v{*ɏ-m6~1?e JQBkN[ss0 I9拓g7IRԝ{aݼT5:3дYK`WV?2˜URJh'{itkK6R 8aX -Ƶ廟zg3ch/ϥ#=Yb+IbaX[===Vg7W]r$c~WW?C bAXE/G)p` ^En CXΝ-_"/aՑ@cd#3~'ׂ6QIi6C&nő-2gshN[J%=R3]|jvy1 "&8ylܟ,-T|Ӱ#(f_<%$^< v ٨нZ#߇2z}]U!#Xe3DaF#-K8} %>(aG02׹l\q#ڵv>Y[S>~`t_9 >sb,Z5dfFTi-w,K*|#U;`Xߓ/]Π*{HP !e}Uy{JD|5AE>bafoqZ_\ YU 㗰isFqH v7\K:#t4POX UmNҬ ɛ:Cx"P $m vb# \UĒEBu!a3g^?H^,t3Y gU\w6/Հ^l%<Y\fH }3T%$BO{Mn*i",2[3"=m)fd#+Vijeqc,HTҊ$ Њl fd8@- #RE_g8{j]s 13TsB]5/GnY6olzE{s`p(4(i.жJW+1 l>6*a9:8 j,1NwᨐED̓)}?v"Ы77!Dnp͔5ha"C:1@?*u6j0`U8FMIs)^EPbS6 T' & ӈ;*yև}`9Ө/DJ8 g‹lg}i%i`M X%Ao0逫蚝 ͂6]YTzB dVJ_  pw]׎EX4۞A6ܕ(#$4i\S)td ڄqJݐ>(`VĦ13si,հEh iNz\-s-:\ʾbX\mR˙]hU(RFٙT e}B!կqg[y%*yY:ٓ x$/VV,M*:%j_~EL1 |(;8+*/fHz&R2Z6>E£Œ?x9c/Sb,XKQ/y~Kigsu.UȎoFSCɆiE R+z$(y;+GU99Ct7 2B50lʠ#aYo^V? ,hm~XPx席s;/HC=V_&sV\6`{o8jX$蒄qsI'!hwLc2Шr̸w7Χx(YrטIC>CqtNbiѫz6G% p%ӕDrߵ2#pL2 b,S l;bK;lf6H"l÷(ֱdTe0a ںP0ǀo^R{]fܘȌ[ Va|+Uh66 ԴzL>6]mM<3x:@agMhBG#95d݇H9sРCBo!1` pF'qz0Fѕ8( ͷG.®btNe9U}RkzZlսZ6!<4N0(`A$/,_[pQj Ij%A%;]A3|2G8sGwχL@-:V3LڜkOʿ?3+Hdv2[Nw@] 7Y6;sޔNm:jQ9˱ܲ"8P-mHO2 SgtH74xEˌȠ 'qP쥴YIjf@j5>ڢ&D@;k4ZW-W\\Oc*ZOS$9zOLț՞ ډ3" QGƚރn*kΓ02Dtcu{ !ڲR 0ĥIl@Pޫ]*܂ +}1$0{'S\ ϸK KM'C>J/ "w*u}J'N)"|KYGֲd ZPv^eіZd6Uf$dyYL yp^)84LnOzdo{*ui "3AGf )OPU4B:$4]ܽ7B8m#Es@e 䚿XaЩ9^]Ruf󞎣"DA4eOٗ+7Њ?g9W軝\Kjhy;hKJ žU{^3;re|q4% ̓ .5zvd`t^v̎5G)+Dzqp@4O6J,*EO9s!Ď_eVlYK޴\s^rd皵eҡU B%#"p0j|Bs Ia Pǒ 6?fsnSG'fa7`IOށ|iR݈$1rE 0שiōN+2RT,%ojpҢy6fيhrK8JHxr„_{erKBۅ}N;{vBr+oN`~3^Cr{ď(` :dekk5r S }+1Ҟ~Z()s%+`oE嬗 FkH(>j.=nDy}xPzw]X${JGf(T/=sRHqggʵ^k(}Q5OG\|nzW ./_Y *eEC Vh yNSB*T}A4_v>+gYWb^fЇNͣ%͕D1mZU:eAxh (YK\Z /9)3lTz¶'ֱiP_^b|XF!n7f-BzȪ ,O{i4jvKvuLKj77n.FYzGoaW|vU<>+XbqgÞл*:-0a͑KpPY n)d$f8ה#cGj.hs).N<.QGq%HwXvCxùk"yQZn4(*4]]O\3[ӟcXJO@,{zW7[Ln]΃VsE7OBr۝L+;J.yDSL00z#=6'fؽyuwOkc8_Zf`\sa_Ѽf]WP F7رUTK'' ,2 ?+MU4 =cakφ6yx2˰دj;KmD}E%KEqĀ>D4%BU\E#\ 3n[vJ@B ?o?1IÇBn<`G[´N0 q)i3c Uz9j$]"X- }O|ᵃ`Yr}f>Jj>JT3d;Pq"6qTH(v'qiz'\~X&rzȁ8H B~ Z9W=A, =I_&>Ґ-XvY E@+m76r{)DbFHvGV_0nʗn ;=r=J9OFD$o蓗`$Dּt[T\̇}20逡.u?uۼ&w=m]G+Wk/{?wIBkn9y0IԠ?_5fTߗ}p1>#]^la[/`%hga:hs sjr)!fx3i"Pn쪤%I]6lǒYeBFuMk1ݷ `}ے~-U0k/?Pi6@G`>hDی fA\}_v"M [,F!՝wYkAfiu}ZwtjYJ\<}7t5Vu^Iu΍`kmɧc`BGRehFű Kb[֑=橊ǍV  "^{2Q.Yl>w/Տ׍[d͐`BxA>Ǹ{nqRi;ÅO X[zjc}FںxxFa'549s2y"{\7ci~$u?⋳ݍBčJᕟ!:$*?Wm9Ey~LF·wq*LHDd#rC0OMP dwh'"2NPimB ki"1ϬPDu!3 ߱>_CgGY% 'rh[ IO{BTߓOڤ+h-1mT0>^GvhH0cu4:ԳRL>H$DRt!OJ;]lj*y27XYaq]LYxŰ?Wa YBX.GLG嬈yneFJ7EhHW%Z1#G,Y(h×ǻL`՟a%lR_}OS^SM&!d !@&{hoyX{HdMHuwk3y[uxLGdXX͡zuV^â|vbE L:je9@ibYڨ#`#%'a1`;>{KVòJ8%Fū1?`a#2t;vϏDfλ0S6)JWF9qa!hn93Q+"F89:U[yf9,D?8>u6 9h=!$gHA,to:@|2t̊?9,0J`{ L+=1aQxv|2TnC?ž[7 _7ǷR N  dyI+5IٝzYЎ_]'DזP\D f|<.W8v\nˢ>ypE7rϖl hYĭ ೺zxtɤTRsD̾%Iew6d`}aLJ-|1.!9R,;mڀ?+XCcVfB(}+@v񜑳7ee YXDaa'Ud2:(pjJQ1WIu8ȞcFE~br 5=]flgzCr3XTIo^v mRu១}xs%k,@*Uq "eю/3{P ^`nf*h[Dl$k!J5Oz!$zΏ LT,ڇN "l1!p? w3yZI XH(e|_l-/PEɖ|]<[_0:mzhEso=3dOL5Tۤ#{P]]IM0#&* AʽPpo7cgEB%K4+m;5GL"z3#; 3]w㐽P-`Vby6rh.,R`4/ÈUX%a@BԤ[t.D&GB873cq>[i畆fF\ RV"CcB ^Lچ"IT}\n,?-CtV5`*kj4?b29Ǖ6Mb/6}8țB' lԩeV$[˰TB|AhS%biD -01^K=]gl-Z6NG`ģibv#JlHm34xRXۦ/f54A`oh5luL Ձ+Go"Y\Ps8C4Ξs.K\vL Cta@sv:x ǓE9ڜ{qc3@T-Kahceeue.mC߶D]3h-3 h(uH(gu5o v +Mi'N;.`ºrOKe /a?=7{G2ls% #YbA0nƒ6sE$,}Vit2UN%XBw CZ|PVAzet VGK'~yex@oo[Zhf#Y Q/ۿ51F[^#_cZ+>93+ZQ=hInIӓ#=ܳӖ|p1^<$jp$(94)ghko~pB4:LrGGMޤrO#n(yYoN׫oqBDTLbT0Gɍ%T1ZR$QgNuZQF*ٻϮ >ѥP+wN);cFQYCDnG J{X~HD.Qg-rlrrk^;W\-h'_\r sZgDx,8S?#$&UX_m(tuol6N܃} ?NĜ (1U/R ʠl@iު8oWyN~6tՄ8LZIG0y"}o9b ۾C>ZBz .'GXe1TJٸ0d\& W 6mP?DM;t[fK]/BK`H/wVy[k赧zO2۽1Z`o]=]&F%y6Am-ǰHssNToGt!grԋ6J:߼ [ήYWd4U)7KF ؈ky]ыZZ1J㉖CrT6 AE/?Ẻe4'*ˉ2)셙yFNT4T&.q%E-Wyi&Zt.xyQVCG{+r~_ N=d"I |LHU5lN6y^޷&sڳ]*OmDZM&nJ C%߄Ba4BtRe + bhD&hv|S(`ˮt5))}9~4x 2tRHm8  pp9IHvg߼7ؚz:ƛ:O0sKE D/`*L47ٮ4[}A Rm>ז-Ȉʪ3d ѮwnĂRT5Ϯ$$mK-#_9&A͌(ܽbN5@].'.aa])yhCy:(bNT˾QCc: [~#>Ulvj?S68[I;Gޛ7v9&$;۝X g%ϼy%~FH lԸ0[+2a#pWn'|Qv|3\vAd-7Yh([&L&A摍]k{(]X[O5VRpΊp/`-71B*ǂS(إ:`rV{ e{^|DWu `J4a.R_ԡ'HXgSοq6SK>Ǜ1gZ:sAcVq)(e3cNp^#4c kQ  YZ