ktexteditor-devel-5.90.0-bp154.1.38 >  A b|a;!M@eeeF! ؘ#eP@h(-Z]rZk ѷWE'0gce<>|%^ \ gM[KOWo].G'UXl޴tg}b -WiP EEx ӸTb<^Z+ܸ#4urf1ZK xM7=24rw{ 9yБ4A ®#Br (p}\icB2HQ :^5b56e3092c6e06ce6ba0fccc8e109926f7031bc6e58f66ea93f4838ecd022bcadae8442d39634b228a891e6d2e9dd7a9c8aadbdbhb|a;!M@eeey3ZT9B戭V_h;JQgmXv5b(q(cⰫ8{[l>(Ew>e/b "k2Т83l Y~YҭBS#M_-)Ց@OEa-/9a(r؍DwwpLR-✤8 dnkLAvf&]"ZK{r#i g wRHAbt>I jwjJa:!q7ވo>p>|?ld & h $,0MVh MM M (M \M )M MMAMM`0(^8hg9 g:+gF>GPMHMIMXY\@M] tM^ bc`defluMv wMxMyz  &hCktexteditor-devel5.90.0bp154.1.38Header files for ktexteditor, an embeddable text editor componentKTextEditor provides a text editor component that can be embedded in applications, either as a KPart or using the KF5::TextEditor library. This subpackage provides the header files.b|alamb23Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Antonio Larrosa Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer lbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgalarrosa@suse.comlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgLuca Beltrame lbeltrame@kde.orgJan Engelhardt lbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.delbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orghrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.com- Update to 5.90.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.90.0 - Changes since 5.89.0: * Add a formatting commit to ignore-list * try to fix behavior for vimode on completion (kde#444883) * Change build system to make building against qt6 * Apply word filter on async completion models (kde#444883) * Validates the input method attributes received from input method. (kde#443977) * fix compile on Mac if EditorConfig is found * Remove unused exporting of SwapFile class symbols * Fix cursor position after completion tail restore * let cmake generate the PCH header completely * Introduce PCH support * Color current indentation line differently * Fix unused capture warning * Vimode-keyparser: Make some functions more efficient * Use KTextEditor::Range by value - Rebase 0001-Disable-KAuth-integration.patch- Update to 5.89.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.89.0 - Changes since 5.88.0: * Bring back git via QProcess * When reloading, don't override auto-detected hl mode if not set by user * If user didn't set them, don't override file type and highlighting modes detection * Pass KTextEditor::Cursor by value everywhere * Use const QString * Revert "completion: invoke always" * Remove selected text if preedit is not empty. * Disable "tail-available-on-undo" in ViInputMode * Fix vi-mode completion unit-tests * Improve built-in search performance * Remove duplicated lua.js indent file * Fix a compiler warning * Review KateTextLine usages * Create a separate path for fetching lineLength * Use iterators for iterating over blocks * Completion in two edits feature describing comment * Re-add "undo removed tail" on completion- Strip 'Source' URL for faster submissions- Update to 5.88.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.88.0 - Too many changes since 5.87.0, only listing bugfixes: * Expand katepart metadata (kde#444714) * TextFolding::importFoldingRanges: get rid of UB (kde#444726)- Update to 5.87.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.87.0 - Changes since 5.86.0: * Add Gitlab CI configuration * The user is not selecting as soon as we clearSelection * fix missing i18n (kde#442071)- Drop the unneeded baselibs.conf.- Update to 5.86.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.86.0 - Too many changes since 5.85.0, only listing bugfixes: * Python indentation: decrease indent when appropriate keyword is typed (kde#392732) * Do not show encoding error when file only contains BOM (kde#440359)- Update to 5.85.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.85.0 - Changes since 5.84.0: * Remove module prefix of include * Network mounts performance optimizations * KateView: speed up large view jumps * Fix apidox for class Mark * better comments * ensure close button on top for replace * move close button to right for bottom widgets- Update to 5.84.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.84.0 - Too many changes since 5.83.0, only listing bugfixes: * WIP: Take into account wordCompletionRemoveTail in completionRange() default implementation (kde#436170)- Update to 5.83.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.83.0 - Too many changes since 5.82.0, only listing bugfixes: * Limit shortcut context to active view for Reuse Word Above/Below (kde#352902) * Add "Transpose Words" feature (kde#436621) * Fix on-the-fly spell checking with recent Qt (kde#436004) * Revert "Add option to keep spaces to the left of cursor when saving" (kde#433455)- Update to 5.82.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.82.0 - Too many changes since 5.81.0, only listing bugfixes: * Fix dragging when folding stuff is around (kde#435500) * Fix incremental selection-only search (kde#327408) * Attempt fix crash on dragging (kde#435500) * fix memory corruption on 'Close the file, discard..' (kde#433180)- Update to 5.81.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.81.0 - Too many changes since 5.80.0, only listing bugfixes: * Don't warn about unsaved changes when closing if blank and unsaved (kde#391208) * Use QPalette::highlight for the scrollbar minimap slider (kde#434690) * Restrict horizontal range of cursor to avoid unintentionally wrapping. (kde#423253) * Add option to keep spaces to the left of cursor when saving (kde#433455) * fix unit tests => don't remove trailing spaces (kde#434163) * fix spellcheck word detection for non-ASCII (kde#433673) * fix auto-completion for non ASCII words (kde#433672)- Update to 5.80.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.80.0 - Too many changes since 5.79.0, only listing bugfixes: * use correct function to determine with of line number characters (kde#430712) * Add option to preselect nothing when automatic completion is invoked (kde#316413) * Temporarily save unfinished search/replace text (kde#411923) * avoid crash on clearing of bookmarks (kde#433006) * [Vimode] Do not remove empty lines when reformatting (kde#340550)- Update to 5.79.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.79.0 - Too many changes since 5.78.0, only listing bugfixes: * [Vimode] Do not switch view when changing case (~ command) (kde#432056) * Increase maximum indentation width to 200 (kde#432283) * Only show bookmark chars error when in vimode (kde#424172) * Retain replacement text as long as the power search bar is not closed (kde#338111) * Allow "Dynamic Word Wrap Align Indent" to be disabled (kde#430987) * [Vimode]Fix search inside fold ranges (kde#376934) * [Vimode] Fix Macro Completion Replay (kde#334032)- Update to 5.78.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.78.0 - Too many changes since 5.77.0, only listing bugfixes: * Show the dragged text when dragging (kde#398719) * Undo indent in one step (kde#373009)- Update to 5.77.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.77.0 - Changes since 5.76.0: * Port KComboBox to QComboBox * use KSyntaxHighlighting themeForPalette * fix i18n call, missing argument (kde#429096) * minor improvements to theme search * Improve the automatic theme selection- Update to 5.76.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.76.0 - Too many changes to list here.- Update to 5.75.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.75.0 - Too many changes to list here.- Update to 5.74.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.74.0 - Too many changes to list here.- Update to 5.73.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.73.0 - Changes since 5.72.0: * Use KF-standardized Qt logging categories * add icons to all buttons of file modified message (kde#423061) * Revert changes in autotests. It seems that camelcase changes breaks them * Use camelcase include. (scripted) * Use the canonical docs.kde.org URLs- Update to 5.72.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.72.0 - Changes since 5.71.0: * Make "goto line" work backwards (kde#411165) * fix crash on view deletion if ranges are still alive (kde#422546)- Update to 5.71.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.71.0 - Changes since 5.70.0: * Add .diff to the file-changed-diff to enable mime detection on windows. * scrollbar minimap: performance: delay update for inactive documents * Make text always align with font base line * Port from KRun::runUrl to OpenUrlJob * Fix modified line marker in kate minimap * Port to KIO::statDetails. We only need StatBasic since we only need the permissions- Update to 5.70.1 * Revert "Store and fetch complete view config in and from session config" (kde#421375)- Update to 5.70.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.70.0 - Changes since 5.69.0: * fix drag'n'drop on left side border widget (kde#420048) * Revert premature port to unreleased Qt 5.15 * Store and fetch complete view config in and from session config- Update to 5.69.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.69.0 - Changes since 5.68.0: * Make it compile against q5.15 (QString:: is deprecated) * Add missing include * fix folding crash for folding of single line folds (kde#417890) * fix unit test * [VIM Mode] Add g g commands (kde#418486) * Add MarkInterfaceV2, to s/QPixmap/QIcon/g for symbols of marks * Draw inlineNotes after drawing word wrap marker- Update to 5.68.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.68.0.php - Changes since 5.67.0: * templates: Convert license statements to SPDX headers * Remove duplicate include * README.md: fix example code & code markup * Fix minor EBN issues (http->https) * Make it compile against last qt5.15 without deprecated method. QOverload::of(&QComboBox::currentIndexChanged) is deprecated * Add an option to dynamic-break inside words * Use ecm_qt_install_logging_categories over manual categories file * KateModeMenuList: don't overlap the scroll bar- Replace %make_jobs with %cmake_build.- Update to 5.67.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.67.0.php - Too many changes since 5.66.0, only listing bugfixes: * fix Drag© function (by using Ctrl Key) (kde#413848)- Update to 5.66.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.66.0.php - Changes since 5.65.0: * Fix warning about unused variable and minor optimization * Add "line-count" property to the ConfigInterface * Avoid unwanted horizontal scrolling (kde#415096) * Port deprecated QSet::toList() method * Update the obsolete projects.kde.org URL- Update to 5.65.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.65.0.php - Changes since 5.64.0: * KateModeManager::updateFileType(): validate modes and reload menu of the status bar * Remove unused include * Remove KIconThemes use * Verify modes of the session config file * LGPLv2+ after ok by Svyatoslav Kuzmich * restore files pre-format * don't touch templates/- Update to 5.64.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.64.0.php - Too many changes since 5.63.0, only listing bugfixes: * fix crash (kde#413474) * add missing s (kde#413158) - Drop 0001-fix-crash-in-variableexpansionhelpers.patch. Merged upstream.- Add 0001-fix-crash-in-variableexpansionhelpers.patch to fix a crash when adding a variable to swap file name (kde#413474)- Update to 5.63.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.63.0.php - Too many changes since 5.62.0, only listing bugfixes: * QRectF instead of QRect solves clipping issues, even thought the rectangle has pure integer coordinates/sizes (kde#390451) * Add keyboard shortcut for switching Input modes to edit menu (kde#400486) * Backup on save: Support time and date string replacements (kde#403583)- Update to 5.62.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.62.0.php - Changes since 5.61.0: * Allow to customize attributes for KSyntaxHighligting themes * More port away from Qt's foreach all loops over method-local containers * Port away from Qt's foreach all loops over rvalue container objects * Port away from Qt's foreach all loops over method-local containers * Fix for all themes: allow turn off attributes in XML highlighting files * play in unit test with better searchText implementation * fix build when using Qt 5.11 * simplify isAcceptableInput + allow all stuff for input methods * simplify typeChars, no need for return code without filtering * Mimic QInputControl::isAcceptableInput() when filtering typed characters (kde#396764) * try to sanitize line endings on paste (kde#410951) * Fix: allow turn off attributes in XML highlighting files * improve word completion to use highlighting to detect word boundaries (kde#360340) * More porting from QRegExp to QRegularExpression * properly check if diff command can be started for swap file diffing (kde#389639) * KTextEditor: Fix left border flicker when switching between documents * Migrate some more QRegExps to QRegularExpression * Add .clangd to .gitignore list * fix vi mode unit test * Allow 0 in line ranges in vim mode. * Use CMake find_dependency instead of find_package in CMake config file template. - Replace foo-devel with cmake(KF5Foo) in build requirements- Update to 5.61.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.61.0.php - Changes since 5.60.0: * Save and load page margins * Don't persist authentication * Re-map default "Switch input mode" shortcut to not confict with konsolepart (kde#409978) * Make keyword completion model return HideListIfAutomaticInvocation by default * Minimap: Do not grab the left-mmouse-button-click on up/down buttons * Fix minor typos * allow up to 1024 hl ranges instead of not higlighting the line at all if that limit is reached * fix folding of lines with end position at column 0 of a line (kde#405197) * move enum to dialog, only used there * Add option to treat some chars also as "auto bracket" only when we have a selection * Add an action to insert a non-indented newline (kde#314395) * Add setting to enable/disable text drag-and-drop (on by default)- Don't lower minimum Qt version anymore, it requires 5.11 now - Drop conditionals for no longer supported distribution versions- Update to 5.60.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.60.0.php - Changes since 5.59.0: * fix goto line centering force center for any external set cursor position call (kde#408418) * Fix bookmark icon display on icon border with low dpi * Fix action "Show Icon Border" to toggle border again * Remove ifdef for Qt 5.11 since we require that version now * Fix compiler warning about unused variable * Fix empty pages in print preview and lines printed twice (kde#348598) * remove no longer used header * fix unit test for all operating systems * fix unit test * fix autoscrolling down speed (kde#408874) * Add default variables for variables interface * Make automatic spellcheck work after reloading a document (kde#408291) * raise default line length limit to 10000 * WIP:Disable highlighting after 512 characters on a line. * KateModeMenuList: move to QListView * Install in new logging directory when we use kf5 5.59.0- Update to 5.59.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.59.0.php - Changes since 5.58.0: * Don't delete entire previous line by backspace in pos 0 (kde#408016) * Use native dialog overwrite check * Review del/backspace * Add action to reset font size * show static word wrap marker always if requested * Ensure highlighted range begin/end marker after unfold * Fix: don't reset Highlight when saving some files (kde#407763) * Auto indentation: Use std::vector instead of QList * Fix: Use default indentation mode for new files * remove duplicated assignment * honor auto-bracket setting for balance check * improve invalid character check on loading (kde#406571) * New menu of syntax highlighting in the status bar * Avoid infinite loop in "Toggle Contained Nodes" action- Update to 5.58.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.58.0.php - Changes since 5.57.0: * Too many changes to list here- Update to 5.57.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.57.0.php - Changes since 5.56.0: * Too many changes to list here- Update to 5.56.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.56.0.php - Changes since 5.55.0: * Remove override keyword * Use isEmpty here * Remove deprecated method * try to improve painting height for text lines - bug 403868 avoid to cut _ and other parts still broken: double height things like mixed english/arab, see bug 404713 (kde#403868) * Use QTextFormat::TextUnderlineStyle instead of QTextFormat::FontUnderline (kde#399278) * Make it possible to show all spaces in the document (kde#381267, kde#342811) * Do not print indent lines * KateSearchBar: Show also search has wrapped hint in nextMatchForSelection() aka Ctrl-H * katetextbuffer: refactor TextBuffer::save() to better separate code paths * Use AuthCore instead of Auth * Remove dead code * Explicitly link against KAuth * Refactor KateViewInternal::mouseDoubleClickEvent(QMouseEvent *e) * Improvements to completion * Add TODO KF6 note * Set the color scheme to Printing for Print Preview (kde#391678) - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Downgrade the Qt version requirement to build with 5.9- Update to 5.55.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.55.0.php - Changes since 5.54.0: * skip cppstyle indentation test for !t 5.12.0 which has a broken regex implementation in JS * KateSpellCheckDialog: Remove action "Spellcheck Selection" * Update JavaScript library underscore.js to version 1.9.1 * Fix bug 403422: Allow changing the marker size again (kde#403422) * Consistently use override, not Q_DECL_OVERRIDE * SearchBar: Add Cancel button to stop long running tasks * Remove explicit use of ECM_KDE_MODULE_DIR, is part of ECM_MODULE_PATH * Review KateGotoBar * ViewInternal: Fix 'Go to matching bracket' in override mode * Delete copy constructor and assignment operator from public vim/ classes * delete copy constructor and assignment operator of some internal classes * Use HTTPS, if available, in links visible to users * Review KateStatusBar * ViewConfig: Add option to paste at cursor position by mouse (kde#363492) * Use the nicer K_PLUGIN_CLASS_WITH_JSON * Remove Qt version check- Update to 5.54.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.54.0.php - Changes since 5.53.0: * Fix unit test that arbitrarily fails * fix scripting for Qt 5.12 * Fix emmet script by using HEX instead of OCT numbers in strings (kde#386151) * Fix broken Emmet (kde#386151) * ViewConfig: Add 'Dynamic Wrap At Static Marker' option * fix folding region end, add ending token to the range * avoid ugly overpainting with alpha * Don't re-mark words added/ignored to the dictionary as misspelled (kde#387729) * KTextEditor: Add action for static word wrap (kde#141946) * ViewPrivate: Don't hide 'Clear Dictionary Ranges' action * KateStatusBar: Reformatted by astyle command to follow coding style * Don't ask for confimation when reloading (kde#401376) * class Message: Use inclass member initialization * KTextEditor::Message: Review documentation * use STL were no implicit sharing is required * Expose KTextEditor::ViewPrivate:setInputMode(InputMode) to KTextEditor::View * improve range handling, no allocations for common updates (kde#333517) * KateViewInternal: Rename getMouse/Cursor() => mouse/cursorPosition() to fit coding style * tune editing actions for large number of small edits * Only cal updateView() in visibleRange() when endPos() is invalid. * KateViewInternal: S&R- Update to 5.53.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.53.0.php - Changes since 5.52.0: * KTextEditor::ViewPrivate: S&R * KateViewInternal: Remove unneeded functions * Allow negative syntax definition priorities. * Expose "Toggle Comment" feature through tools menu and default shortcut (kde#387654) * Fix hidden languages in the mode menu * SpellCheckBar: Use DictionaryComboBox instead of plain QComboBox * KTextEditor::ViewPrivate: Avoid warning "Text requested for invalid range" * Android: No need to define log2 anymore * disconnect contextmenu from all aboutToXXContextMenu receivers (kde#401069) * Introduce AbstractAnnotationItemDelegate for more control by consumer- Update to 5.52.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.52.0.php - Changes since 5.51.0: * Remove unused variables * Fix minor EBN issues and typos * Fix align of doxygen comments in templates * Use normalized signatures with SIGNAL(), SLOT(), Q_ARG(), Q_RETURN_ARG() * Remove duplicated includes * Use more explicit constructors with internal classes * Remove double underscore (__) from header include guards * Minor: Cleanup some code- Run spec-cleaner- Update to 5.51.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.51.0.php - Changes since 5.50.0: * Restaure default severity * Autogenerate debug file + create categories file * Port to no deprecated method * Paint code folding marker only for multiline code folding regions * Intialize m_lastPosition * Scripting: isCode() returns false for dsAlert text * fix ebn issues * use R Script hl for R indent tests * Unit tests for the R indent script * Update of the R indent script * Fix Solarized Light and Dark color schemes (kde#382075) * Don't require Qt5::XmlPatterns- Trim bias from description.- Update to 5.50.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.50.0.php - Changes since 5.49.0: * Too many changes to list here - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Update to 5.49.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.49.0.php - Changes since 5.48.0: * proper fix for the raw string indenting auto-quoting * fix indenter to cope with new syntax file in syntaxhighlighting framework * adjust test to new state in syntax-highlighting repository * Show "Search wrapped" message in center of view for better visibility * fix warning, just use isNull() * Extend Scripting API * fix segfault on rare cases where empty vector occurs for word count happens e.g. sometimes for vimode_emulatedcommandbar test * enforce clear of scrollbar preview on document clear BUG: 374630 (kde#374630)- Update to 5.48.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.48.0.php - Changes since 5.47.0: * use nullptr, not 0 * add missing const qualifiers * guard updateConfig for disabled status bars * add context menu to statusbar to toggle show total lines/word count * Implemented displaying of total lines in kate (kde#387362) * Make menu-bearing toolbar buttons show their menus with normal click rather than click-and-hold (kde#353747) * CVE-2018-10361: privilege escalation * Fix caret width (kde#391518)- Update to 5.47.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.47.0.php - Changes since 5.46.0: * Warning-- * Use override * Don't use title case for the "show word count" checkbox * Make the word/char count a global preference- Update to 5.46.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.46.0.php - Changes since 5.45.0: * optimization of KTextEditor::DocumentPrivate::views() * [ktexteditor] much faster positionFromCursor * Implement single click on line number to select line of text * Warning-- * Add missing override * Fix problem that font/italic/... attributes no longer work with e.g. >= Qt 5.9 * clang-tidy: modernize-use-default-member-init run - Dropped patches, now upstream: * Fix-font-attributes.patch- Add Fix-font-attributes.patch to fix missing bold/italic/... markup with modern Qt versions (>= 5.9)- Update to 5.45.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.45.0.php - Changes since 5.44.0: * Make it possible for KTextEditor to build on Android NDK's gcc 4.9 * avoid Asan runtime error: shift exponent -1 is negative * We depend against 5.8.0 * optimization of TextLineData::attribute * Don't calculate attribute() twice. * Revert Fix: View jumps when Scroll past end of document is enabled (kde#391838) * don't pollute the clipboard history with dupes * Revert "[KateCompletionWidget] Create configuration interface on demand" (kde#391955) * [KateCompletionWidget] Create configuration interface on demand * Remove not necessary QtCore and co- Update to 5.44.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.44.0.php - Changes since 5.43.0: * Initialize value * Iterate over initializer_lists to avoid mem allocs * Add icons for KTextEditor Document-Export, Bookmark-Remove and Formatting Text Upppercase, Lowercase and Capitalize- Update to 5.43.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.43.0.php - Changes since 5.42.0: * improve line heigh computation try to avoid cutting of parts of glyphs * Fix: View jumps when Scroll past end of document is enabled (kde#306745) * KateView unit test: simplify finding KateViewInternal * Use at least the requested width for the argument hint tree * ExpandingWidgetModel: find the right-most column based on location * Simplify code: return early to reduce indentation depth- Update to 5.42.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.42.0.php - Changes since 5.41.0: * Remove obsolete reviewboardrc file * clang-tidy modernize-use-override * Fix wildcard matching for modelines * Fix Unit Test * Fix compilation * Fix a regression caused by changing backspace key behavior * port to non-deprecated API like already used at other place (kde#386823) * Add missing include for std::array * MessageInterface: Add CenterInView as additional position * Verify if QTest::qWaitForWindowExposed returns true * QStringList initializer list cleanup * Migrate some QRegExps to QRegularExpression * Fix warning about unused variable * Fix syntax unit tests * Fix API documentation about RangeCommand- Update to 5.41.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.41.0.php - Changes since 5.40.0: * Use directly QStringLiteral * We depend against 5.7 * API dox: fix section id * Plugin template: remove bogus translation strings * Fix VI-Mode buffer commands * Remove unused member variable * prevent accidental zooming. * autotests: Remove dep on Qt5::Script again * Fix: Missing dependencies for ktexeditor autotests- Update to 5.40.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.40.0.php - Changes since 5.39.0: * API dox: fix wrong names of methods and args, add missing \since * Avoid (certain) crashes while executing QML scripts (kde#385413) * Avoid a QML crash triggered by C style indentation scripts * - Increase size of trailing mark * add autotests for D8333 * fix some indenters from indenting on random characters * Fix deprecation warning - Remove patches, now upstream: * fix-some-indenters-from-indenting-on-random-characters.patch- Add fix-some-indenters-from-indenting-on-random-characters.patch to fix broken indentation of some languages (e.g. Python)- Update to 5.39.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.39.0.php - Changes since 5.38.0: * Ignore default mark in icon border for single selectable mark * Minor spell check interface fixes * Use QActionGroup for input mode selection * Fix missing spell check bar (kde#359682) * Fix the fall-back "blackness" value for unicode > 255 characters. (kde#385336) * Plugin template: fix name of Messages.sh * Fix trailing space visualization for RTL lines. * fix typo approved by Dominik Haumann- Add 0001-Disable-KAuth-integration.patch * Streamlined way to disable KAuth support from ktexteditor - Remove patches, folded into the above: * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.38.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.38.0.php - Changes since 5.37.0: * Port Document/View scripting API to QJSValue-based solution * Show icons in icon border context menu * Use config.h more * Fix compilation on windows with editorconfig-c-core available * Replace KStandardAction::PasteText with KStandardAction::Paste * Support fractional scaling in generating the sidebar preview * Fix build with QT_NO_ACCESSIBILITY * Switch from QtScript to QtQml- Update to 5.37.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.37.0.php - Changes since 5.36.0 : * Handle fine-grained wheel event in zooming * Add template for a ktexteditor plugin * Add KF6 TODO for missing argument namespace in slot signature * copy permissions from original file on save copy BUG: 377373 (kde#377373) * perhaps avoid stringbuild crash BUG: 339627 (kde#339627) * fix problem with * adding for lines outside of comments BUG: 360456 (kde#360456) * fix save as copy, it missed to allow overwriting the destination file we check if we want that via a dialog, but we still always fail to do so BUG: 368145 (kde#368145) * Adapt unit test to changes from KSyntaxHighlighting framework * Command 'set-highlight': Join args with space * fix crash on view destruction because of non-deterministic cleanup of objects * Emit signals from icon border when no mark was clicked * Fix crash in vi input mode (sequence: "o" "Esc" "O" "Esc" ".") (kde#377852) * Use mutually exclusive group in Default Mark Type- Update to 5.36.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.36.0.php - Changes since 5.35.0: * Fix cpu usage spiking after showing vi command bar (kde#376504) * Fix jumpy scrollbar-dragging when mini-map is enabled. * Jump to the clicked scrollbar position when minim-map is enabled. (kde#368589) * [FEATURE] Option to build & install QCH file with the public API dox- Update to 5.35.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.35.0.php - Changes since 5.34.0: * Add Q_FALLTHROUGH * Add missing break * Unbreak KateSyntaxTest in paths with dots, check only dir entry name for . * Revert "Add temporary debug output for investigating KateSyntaxTest fail on CI" * Add temporary debug output for investigating KateSyntaxTest fail on CI * Remove duplicated path separator * Unbreak autotests in paths with spaces, properly escape " chars * Use explicit flag values or explicit constructor instead of nullptr- Update to 5.34.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.34.0.php - Changes since 5.33.0: * KAuth integration in document saving - vol. 2 - various security improvements * Fix assertion when applying code folding that changes cursor position * Use non-deprecated root element in ui.rc file * Add scroll-bar-marks also to the built-in search&replace * KAuth integration in document saving - Revert upstream feature as disliked by the security team (boo#1033055) * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.33.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.33.0.php - Changes since 5.32.0: * Upgrade ECM and KF5 version requirements for 5.33.0 release. * fix debug warning (and wrong pen value) found by kfunk, introduced my me * Expose additional internal View's functionality to the public API * Upgrade KF5 version to 5.33.0. * save a lot of allocation for setPen * Fix ConfigInterface of KTextEditor::Document * Add unit test for KTextEditor::ConfigInterface * Added font and on-the-fly-spellcheck options in ConfigInterface- Enable editorconfig support only on TW and Leap >= 42.2- Enable editorconfig support- Update to 5.32.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.32.0.php - Changes since 5.31.0: * Commit translations from l10n-kf5 * Fix compilation with Qt 5.6 * Upgrade ECM and KF5 version requirements for 5.32.0 release. * Remember file type set by user over sessions * Reset filetype when opening url * Added getter for word-count configuration value * vimode_completion unit test failure * Consistent conversion from/to cursor to/from coordinates * Update file type on save only if path changes * EditorConfig support * add FindEditorConfig to ktexteditor if that proves to be useful, can be moved to extra-cmake-modules, thought I see its use is rather specialized to ktexteditor * Fix: emmetToggleComment action doesn't work * Use sentence style capitalization with label texts of edit fields * Reverse meaning of :split, :vsplit to match vi and Kate actions. * Use C++11 log2() instead of log() / log(2) * KateSaveConfigTab: put spacer behind last group on Advanced tab, not inside * KateSaveConfigTab: Remove wrong margin around content of Advanced tab * Borders config subpage: fix scrollbar visibility combobox being off-placed * Upgrade KF5 version to 5.32.0.- Update to 5.31.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.31.0.php- Update to 5.30.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.30.0.php- Update to 5.29.0 * Prevent Qt warnings about an unsupported clipboard mode on Mac * Use syntax definitions from KF5::SyntaxHighlighting * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.29.0.php- Update to 5.28.0 * Breeze Dark: Darken current-line background color for better readability (kde#371042) * Sorted Dockerfile instructions * Breeze (Dark): Make comments a bit lighter for better readability (kde#371042) * Fix CStyle and C++/boost indenters when automatic brackets enabled (kde#370715) * Add modeline 'auto-brackets' * Fix inserting text after end of file (rare case) * Fix invalid xml highlighting files * Maxima: Remove hard-coded colors, fix itemData Label * Add OBJ, PLY and STL syntax definitions * Add syntax highlighting support for Praat * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.28.0.php- Update to 5.27.0 * XML files: remove hard-coded color for values * XML: Remove hard-coded color for values * XML Schema Definition: Turn 'version' into an xs:integer * Highlighting definition files: round version up to next integer * Support multi char captures only in {xxx} to avoid regressions * Support regular expressions replaces with captures > \9, e.g. I (kde#365124) * Fix rendering of characters spanning into next line, e.g. underlines are no longer cut off with some fonts/font-sizes (kde#335079) * Fix crash: Make sure the display cursor is valid after text folding (kde#367466) * KateNormalInputMode needs to rerun SearchBar enter methods * try to "fixup" rendering of underlines and stuff like that (kde#335079) * Show "View Difference" button only, if 'diff' is installed * Use non-modal message widget for externally modified file notifications (kde#353712) * Fix regression: testNormal did only work because of test execution at once * Split the indent test into separate runs * Support "Unfold Toplevel Nodes" action again (kde#335590) * Fix crash when showing top or bottom messages multiple times * Fix eol setting in mode lines (kde#365705) * Highlight .nix files as bash, guess can't hurt (kde#365006) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.27.0.php- Update to 5.26.0 * Remove accel clash (kde#363738) * Fix email address highlighting in doxygen (kde#363186) * Detect some more json files, like our own projects ;) * Improve mime-type detection (kde#357902) * Bug 363280 - highlighting: c++: #if 1 #endif #if defined (A) aaa [#]elif defined (B) bbb #endif (kde#363280) * Bug 351496 - Python folding is not working during initial typing (kde#351496) * Bug 365171 - Python syntax highlighting: not working correctly for escape sequences (kde#365171) * Bug 344276 - php nowdoc not folded correctly (kde#344276) * Bug 359613 - Some CSS3 properties are not supported in syntax highlight (kde#359613) * Bug 367821 - wineHQ syntax: The section in a reg file isn't highlighted correctly (kde#367821) * Improve swap file handling if swap directory specified * Fix crash when reloading documents with auto-wrapped line due to line length limit (kde#366493) * Fix constant crashes related to the vi command bar (kde#367786) * Fix: Line numbers in printed documents now starts at 1 (kde#366579) * Backup Remote Files: Treat mounted files also as remote files * Cleanup logic for searchbar creation * Add highlighting for Magma * Allows only one level of recursion * Fix broken swap-file on windows * Patch: add bitbake support for syntax highlighting engine * Autobrace: look at spellcheck attribute where the character was entered (kde#367539) * Highlight QMAKE_CFLAGS * Don't pop out of the main context * Add some executable names that are commonly used * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.26.0.php- Update to 5.25.0 * Qt >= 5.5 is now required * Do not ask for overwriting a file twice with native dialogs * Added FASTQ syntax * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.25.0.php- Update to 5.24.0 * Show Scrollbar Text Preview after a delay of 250ms * Hide preview and stuff on view content scrolling * Set parent + toolview, I think this is needed to avoid task switcher entry in Win10 * Remove "KDE-Standard" from encoding box * Folding preview on per default * Avoid dashed underline for preview & avoid poisoning of line layout cache * Always enable "Show preview of folded text" option * TextPreview: Adjust the grooveRect-height when scrollPastEnd is enabled * Scrollbar preview: use groove rect if scrollbar does not use full height * Add KTE::MovingRange::numberOfLines() just like KTE::Range has * Code folding preview: set popup height so that all hidden lines fit * Add option to disable preview of folded text * Add modeline 'folding-preview' of type bool * View ConfigInterface: support 'folding-preview' of type bool * Add bool KateViewConfig::foldingPreview() and setFoldingPreview(bool) * Feature: Show text preview when hovering over folded code block * KateTextPreview: add setShowFoldedLines() and showFoldedLines() * Add modelines 'scrollbar-minimap' [bool], and 'scrollbar-preview' [bool] * Enable mini-map scrollbar by default * New feature: Show text preview when hovering over the scrollbar * KateUndoGroup::editEnd(): pass KTE::Range by const ref * Fix vim-mode shortcut handling, after behaviour changes in Qt 5.5 (kde#353332) * Autobrace: don't insert ' character in text * ConfigInterface: add scrollbar-minimap config key to enable/disable scrollbar mini map * Fix KTE::View::cursorToCoordinate() when top message widget is visible * Refactoring of the Emulated Command Bar * Fix drawing artifacts when scrolling while notifications are visible (kde#363220) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.24.0.php- Update to 5.23.0 * Fix default encoding to UTF-8 (kde#62604) * Fix color configurability of default style "Error" * Search & Replace: Fix replace background color (regression introduced in v5.22) (kde#63441) * New color scheme "Breeze Dark", see https://kate-editor.org/?post=3745 * KateUndoManager::setUndoRedoCursorOfLastGroup(): pass Cursor as const reference * sql-postgresql.xml improve syntax highlighting by ignoring multiline function bodies * Add syntax highlighting for Elixir and Kotlin * VHDL syntax highlighting in ktexteditor: add support for functions inside architecture statements * vimode: Don't crash when given a range for a nonexistent command (kde#60418) * Properly remove composed characters when using Indic locales * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.23.0.php- Update to 5.22.0 (boo#980066) * Use proper char syntax '"' instead of '\"' * doxygen.xml: Use default style dsAnnotation for "Custom Tags" as well (less hard-coded colors) * Add option to show the counter of words * Improved foreground color contrast for search & replace highlightings * Fix crash when closing Kate through dbus while the print dialog is open (kde##356813) * Cursor::isValid(): add note about isValidTextPosition() * Add API {Cursor, Range}::{toString, static fromString} * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.22.0.php- Update to 5.21.0 (boo#974793) * Revert "Open/Save config page: Use term "Folder" instead of "Directory"" * Open/Save config page: Use term "Folder" instead of "Directory" * kateschemaconfig.cpp: use correct filters with open/save dialogs (kde#343327) * c.xml: use default style for control flow keywords * isocpp.xml: use default style "dsControlFlow" for control flow keywords * c/isocpp: add more C standard types * KateRenderer::lineHeight() returns an int * printing: use font size from selected printing schema (kde#356110) * cmake.xml speedup: Use WordDetect instead of RegExpr * Change tab with to 4 instead of 8 * Fix changing the current line number color * Fix selecting completion item with the mouse (kde#307052) * Add syntax highlighting for gcode * Fix the MiniMap selection background painting * Fix encoding for gap.xml (use UTF-8) * Fix nested comment blocks (kde#358692) * Upgrade Qt version requirement to 5.4.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.21.0.php - Drop upstreamed 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Added 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Update to 5.20.0 (boo#970856) * Fix highlighting of all occurences in ReadOnlyPart * Don't iterate over a QString as if it was a QStringList * Properly initialize static QMaps * Prefer toDisplayString(QUrl::PreferLocalFile) * Support surrogate character sending from input method * Do not crash on shutdown when text animation is still running * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.20.0.php- Update to 5.19.0 (boo#967668) * Better behaviour for "insert braces around" autobrace feature * Change option key to enforce new default, Newline at End of File = true * Remove some suspicious setUpdatesEnabled calls (kde#353088) * Delay emitting of verticalScrollPositionChanged until all stuff is consistent for folding (kde#342512) * Patch updating tag substitution (kde#330634) * Only update the palette once for the change event belonging to qApp (kde#358526) * Append newlines at EOF by default * Add NSIS syntax highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.19.0.php- Update to 5.18.0 * Syntax h/l for pli: builtin functions added, expandable regions added * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.18.0.php- Update to 5.17.0 * Add syntax highlighting for TaskJuggler and PL/I * Make it possible to disable keyword-completion via the config interface. * Resize the tree when the completion model got reset. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.17.0.php- Update to 5.16.0 (boo#955067) * highlighting: gnuplot: add .plt extension * fix validation hint, add hint about the compile time validation * Don't crash when command is not available. * Fix kde##307107 * Haskell highlighting variables starting with _ * simplify git2 init, given we require recent enough version (kde#353947) * bundle default configs in resource * syntax highlighting (d-g): use default styles instead of hard-coded colors * better scripts search, first user local stuff, then the stuff in our resources, then all other stuff, that way the user can overwrite our shipped scripts with local ones * package all js stuff in resources, too, only 3 config files missing and ktexteditor could be just used as a library without any bundled files * next try: put all bundled xml syntax files into a resource * add input mode switch shortcut (kde#347769) * bundle xml files in resource * syntax highlighting (a-c): migrate to new default styles, remove hard-coded colors * syntax highlighting: remove hard-coded colors and use default styles instead * syntax highlighting: use new default styles (removes hard-coded colors) * Better "Import" default style * Introduce "Save As with Encoding" to save a file with different encoding, using the nice grouped encoding menu we have and replacing all save dialogs with the correct ones of the operating system without loosing this important feature. * bundle ui file into lib, using my extension to xmlgui * Printing again honors the selected font & color schema (kde#344976) * Use breeze colors for saved and modified lines * Improved icon border default colors of scheme "Normal" * autobrace: only insert brace when next letter is empty or not alphanumeric * autobrace: if removing start parenthesis with backspace, remove end as well * autobrace: only establish connection once * Autobrace: eat closing parentheses under some conditions * Fix shortcutoverride not being forwarded to the mainwindow * Bug 342659 - Default "bracket highlighting" color is hard to see (Normal schema fixed) (kde#342659) * Add proper default colors for "Current Line Number" color * bracket matching & auto-brackets: share code * bracket matching: guard against negative maxLines * bracket matching: just because the new range matches the old doesn't mean no update is required * Add the width of half a space to allow painting the cursor at EOL * fix some HiDPI issues in the icon border * fix kde##310712: remove trailing spaces also on line with cursor (kde#310712) * only display "mark set" message when vi input mode is active * remove & from button text (kde#345937) * fix update of current line number color (kde#340363) * implement brackets insert on writing a bracket over a selection (kde#350317) * auto brackets (kde#350317) * fix alert HL (kde#344442) * no column scrolling with dyn word wrap on * remember if highlighting was set by user over sessions to not loose it on save after restore (kde#332605) * fix folding for tex (kde#328348) * fixed kde##327842: End of C-style comment is misdetected (kde#327842) * save/restore dyn word wrap on session save/restore (kde#284250) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.16.0.php- Update to 5.15.0 * Validate more regexp * Fix regexps in HL files (kde#352662) * Sync ocaml HL with state of https://code.google.com/p/vincent-hugot-projects/ before google code is down, some small bugfixes * Add word-break (kde#352258) * Validate line before calling folding stuff (kde#339894) * Fix Kate word count issues by listening to DocumentPrivate instead of Document (kde#353258) * Update Kconfig syntax highlighting: add new operators from Linux 4.2 * Sync w/ KDE/4.14 kate branch * Minimap: Fix scrollbar handle not being drawn with scrollmarks off. (kde#352641) * Syntax: Add git-user option for kdesrc-buildrc * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.15.0.php- Update to 5.14.0 * Merge allocation of TextLineData and ref count block. * Change default keyboard shortcut for "go to previous editing line" * Syntax highlighting Haskell comment fixes * Speed up code-completion pop-up appearance * minimap: Attempt to improve the look and feel (kde#309553) * nested comments in Haskell syntax highlighting * Fix problem with wrong unindent for python (kde#351190) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.14.0.php- Update to 5.13.0 * The Qt version requirement has been bumped from 5.2 to 5.3 * Debug output has been ported to categorized output, for less noise by default * Docbook documentation has been reviewed and updated * Guard default log level for Qt < 5.4.0, fix log cat name * Add hl for Xonotic (kde#342265) * Add Groovy HL (kde#329320) * Update J highlighting (kde#346386) * Make compile with MSVC2015 * Less iconloader use, fix more pixelated icons * Enable/disable find all button on pattern changes * Improved search & replace bar * Remove useless ruler from powermode * More slim search bar * vi: Fix misreading of markType01 flag * Use correct qualification to call base method. * Remove checks, QMetaObject::invokeMethod guards itself against that already. * Fix HiDPI issues with color pickers * Cleanup coe: QMetaObject::invokeMethod is nullptr safe. * More comments * Change the way the interfaces are null safe * Only output warnings and above per default * Remove todos from the past * Use QVarLengthArray to save the temporary QVector iteration. * Move the hack to indent group labels to construction time. * Fixup some serious issues with the KateCompletionModel in tree mode. * Fix broken model design, which relied on Qt 4 behavior. * Obey umask rules when saving new file (kde#343158) * Add meson HL * As Varnish 4.x introduces various syntax changes compared to Varnish 3.x, I wrote additional, separate syntax highlighting files for Varnish 4 (varnish4.xml, varnishtest4.xml). * Fix HiDPI issues * vimode: don't crash if the command gets executed in the end of a document. (kde#350299) * Support QML multi-line strings. * Fix syntax of oors.xml * Add CartoCSS hl by Lukas Sommer (kde#340756) * Fix floating point HL, use the inbuilt Float like in C (kde#348843) * Split directions did got reversed (kde#348845) * Bug 348317 - [PATCH] Katepart syntax highlighting should recognize \u0123 style escapes for JavaScript (kde#348317) * Add *.cljs (kde#349844) * Update the GLSL highlighting file. * Fixed default colors to be more distinguishable * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.13.0.php- Update to 5.12.0 * debianchangelog.xml: add Debian/Stretch, Debian/Buster, Ubuntu-Wily * Fix for UTF-16 surrogate pair backspace/delete behavior. * Let QScrollBar handle the WheelEvents (kde#340936) * Apply patch from KWrite devel top update pure basic HL * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.12.0.php- Update to 5.11.0 * Allow like in KDE 4.x times 3rdparty apps/plugins to install own highlighting XML files into katepart5/syntax * Add KTextEditor::Document::searchText() * Bring back use of KEncodingFileDialog (kde#343255) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.11.0.php- Update to 5.10.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.10.0.php- Update to 5.9.0 * Add kdesrc-buildrc highlighting file * syntax: added support for binary integer literals in the PHP highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.9.0.php- Add explicit kiconthemes-devel BuildRequires- Update to 5.8.0 * Add word count statistics in statusbar * vimode: fix crash when removing last line in Visual Line mode * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.8.0.php- Update to 5.7.0 * Fixed high-precision touchpad scrolling * Do not emit documentUrlChanged during reload * Do not break cursor position on document reload in lines with tabs * Do not re(un)fold the first line if it was manually (un)folded * vimode: command history through arrow keys * Do not try to create a digest when we get a KDirWatch::deleted() signal * Performance: remove global initializations * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.7.0.php- Update to 5.6.0 * Fix build on MSVC. * vimode bugfixes * add syntax file for Oracle PL/SQL * ppd highlighting: better support for multiline values * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.6.0.php- Update to 5.5.0 * Fix kde#340212: incorrect soft-tabs alignment after beginning-of-line * Add libgit2 compile-time check for threads support * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.5.0.php- Update to 5.4.0 * Implement "go to last editing position" action * Guard against a possibly broken code folding state on disk * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.4.0.phplamb23 1652318470  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN5.90.05.90.0-bp154.1.385.90.0-bp154.1.38 KTextEditorKTextEditorAbstractAnnotationItemDelegateAnnotationInterfaceApplicationAttributeCodeCompletionInterfaceCodeCompletionModelCodeCompletionModelControllerInterfaceCommandConfigInterfaceConfigPageCursorDocumentDocumentCursorEditorInlineNoteInlineNoteInterfaceInlineNoteProviderLineRangeMainWindowMarkInterfaceMessageModificationInterfaceMovingCursorMovingInterfaceMovingRangeMovingRangeFeedbackPluginRangeSessionConfigInterfaceTextHintInterfaceViewktexteditorabstractannotationitemdelegate.hannotationinterface.happlication.hattribute.hcodecompletioninterface.hcodecompletionmodel.hcodecompletionmodelcontrollerinterface.hcommand.hconfiginterface.hconfigpage.hcursor.hdocument.hdocumentcursor.heditor.hinlinenote.hinlinenoteinterface.hinlinenoteprovider.hlinerange.hmainwindow.hmarkinterface.hmessage.hmodificationinterface.hmovingcursor.hmovinginterface.hmovingrange.hmovingrangefeedback.hplugin.hrange.hsessionconfiginterface.htexthintinterface.hview.hktexteditor_export.hktexteditor_version.hKF5TextEditorKF5TextEditorConfig.cmakeKF5TextEditorConfigVersion.cmakeKF5TextEditorTargets-none.cmakeKF5TextEditorTargets.cmakelibKF5TextEditor.soqt_KTextEditor.prikdevfiletemplatestemplatesktexteditor-plugin.tar.bz2/usr/include/KF5//usr/include/KF5/KTextEditor//usr/include/KF5/KTextEditor/KTextEditor//usr/include/KF5/KTextEditor/ktexteditor//usr/lib64/cmake//usr/lib64/cmake/KF5TextEditor//usr/lib64//usr/lib64/qt5/mkspecs/modules//usr/share//usr/share/kdevfiletemplates//usr/share/kdevfiletemplates/templates/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Backports:SLE-15-SP4/standard/1341c6e10b624967dd590bc9eb5ad14e-ktexteditorcpioxz5x86_64-suse-linuxdirectoryC source, ASCII textC++ source, ASCII textASCII textPOSIX tar archive (bzip2 compressed data, block size = 900k)PT7<@&Lh_KButf-89c4adc35aef5068800d54dcee968465cf16c296f34fe0a557408db5a3461a879? 7zXZ !t/a4] crt:bLL &p\-$;+p7h"n?혒V˰h5w ;)EplҩʮKʲ.n8]< g,?4X ј,´{;Ӻ{0`#ϜnXnXNY Ɔ&4veg1j X7hGOWXD@x!f.e$jIY{iӳ[?dh=8W/:*hkIȀɑ7d*٪U}#I9 (V@xt6GsI 0 o٧;/-AXP+y =7df:\֭WW`u7̛~_q(63^fS/ERD{cx6ᗚ$3D="D4'gD؜.i˜H|.{yebC{qWnl{Fs28aC7IMǭ ͡;c]}/S A*Zbk:!s2?LFCمyne?(WjZ}Zrw;ћ/2e3t ,u8H{R!z~ZvS٘R&~F?kz$\˳XscoVp^7ՇLVTXwdaVf'jic!KiF8 Z(%Q^]zg y Q{׮NO ~:ٽlO1Ӕm> a,׷zD& h6QٍuƐHQF0b }q*6tlMs-֛arx\ p@XGJC^˶?{|JhrUR|c[xnT{K&7茄\QuZ}ɡb Ksq>5py(\)#\bqh<|TXeJ35k=l]S(eIxodz@;+ kTcWÉ {1d_XP؞- F,y/].{TksΛ ;7`㝺jޥxJр JkE=uMiƒz]nẚvK)zIAnPjg( ;(kK^i*ߵfcCT4^Y'JB0VxhE⤠lPP`3VFBccU'z#a}ٶd.=U#CjPDaJ0 `,:*wc@X8yjOUTMFvްE''}fngИgw^Q贷jIzoXx$6'[V&@~l_gx JZٖKt9aq7 TI7;-y^x5 9~f>ߙG‹ЊʡYAx&T6OE5#Tt橵@0]zOr?Q$1p{tф: Qf&0/لs ګ #\lDƚz\df!tP*#|C &3Pɂ2wÐXgU&o9 [`Ev١3/(J& s_I#m\j5H豩%xC$"ϩ*w%jPEv6 .کM % kr954ѦƩʽHxf 4'{NQVF}c@Ty5>VO_PN=;gi`n :ءfLP r]IN#^-HfЖ0ॖI ݐLCUt8 <@ w$O,"*iȎ9p=w{a k7|W~ Q(c;I&zijOqv0pY6zErm݌Դ_ۭ@.(Z-A2/JQ(Xs3iCM3)v>ǵ{XZvԷBėTI{:q0W+ެFzjϢPd6nb'90goB1؞{_q8(Hu7[I'䃎VGf6M|)tG0(.7/M{]5!I? Gm]A:[۪ xZr\ן4Ow&B'N粇ފC[y -!TG)^}&kE@ʼi22潊n{cty57C0GmS9 1'mnm"H.qEvz:Q޵dqrr-ׁ [Шz* *?E2%mUP@jp5{oz7F(p>(23< 4.¼bҬH y=Dp6wǷL:3rΔmssӹd HF$pLD5?hhC8{Z Gk(U% U[*!+ԇkPLƉ0 xq n6ɪ2sovWZI1FC5q+-rȱs|$ac%Q %=gX &Q;W H tTh:\SRp gpH{+.ov+-@1 ly:D,Twñ | -#|ְUV΀wb n9HU!z(*lwgTG,&`)yGL[P?9~T&d* _,Ecs(g9J'rw#wLmZFuS%ao^bb9 ^h[&B=Û\G u%ym߁bYun_#&~\GI9p[!!õ@MsӀ(bG@ ә?}!Z)x w*mdT&&󲲊.oi~bIJ{abKύ˖VLS#77ɥjc* $;1" -#vlSgN&d8uUmq 8h6/G1+QO_X>y 3b&$nX|&s3uT{kam̐&kʥj&C FrN:@C^aA[XZ kM&7aO2Y-zw䰉WVFH]-fNJ OW<7!7F3̈7,}`ug%ؖ5:*q^u{/ܲ4\2p۵܃(u_Y26vCAk;{ wNH"~dZaRoRI^-boibNWfG٘ QY:"#R#kDTSһY-0nQҍIjg8PLqIתݱЩZby/ͦeoS vI u8a@&1_{{d]YRXkXe0Rl'CSeGJ,o^դH6\Z(n>GϘ'.ƽwA8v2I'Iw)R4g}ׅ*$^]3R}%"B=F"3ö/*Bfڨ$!۷|Fmͭ=ڥjU 2tN_f ߿cMPQ[mf3^EBֆKLwОzwOԳ0Co͞2r]&߮E!B рӃn+\y(/!쫦X)<}Z}Cm(>aH^2闘`ߎ:_db{i˻p_5fj~@Zw8悤*vq:`It沠t:娅G[ ;6x+|/gāNWIS^D5QH4#2Ѥgޒf\qgܖ\{sc@Z){*KB50-kmILJj0JLbso 42;S+*ͥ^HXޣg9#?TE okMI|dwN{j k@_ ;S4uXktWVe-Th}!asƠKqdMD3_Ȯ^em- \3vZH0gȄw 5uwMVG\X41zo#^& Kz}yf0GĊBŜ8 Pc$ Xw6P8x_U^&"IH "v^49Wr7ba\[SWR%C@_b]&י`V! hͶ7i>V&+lSH~w5;|OiCeKpCH25mmuʤ ц?uͥ޸/࠽Ϧ䷥ a4gElqet#F75rM5$VK֮PAv^ ,\ŕ1 "3콕FQd3#eͭVrq~ >*j 8"lS%_$#-Wwԃ&E~sLPGE>-q7I# V]`6'P': BsGj$ &a)b@4^Iy~ PP=]Ё=%}_}VHF\MvAOmɹ`mtq*8QPYp.0#8A)d‹&Ӌ]`$HJ0b 7'3sChɸeN.b8XKVe 8'A'<T2Ue:mْmT!ZC!0բ;i1l> pى)lu[f0SUhV ]+K `1FN4uBJrq㛗owm>PjN{g@n?]㐩{>Uq^Nx.Gxؔ2'iSFDz=2TxuXcddR\]X8[@k[巸T>AE_ċHzچcMlIX[KN_W3,Gفk¢>on{ñrY,).z?/g'U+PWOe>c.>#TD4 IY| k8hcSvԐ]miV(U$y'q| A&';rD@c^B nZ ƎsԯuV.^OvMxyI+T[t ˳uՍ;LbcYC)ΌԺ{-Nfllc8ʵݓCCwb@ʯa~Dk3ܭۓ4^TG)Lbfgĩ| B*CG.$[PNrTU,!E33`'C$,] tNǎk2H ńEDm#%Q ^KeY@rtkvgiH<2=UIY=_v;kL7&MpPpEs/,`e,FV7ZtLqG5 tvx"߇ʢ?Ⱥ=U_t̏ӱ#3ECt?䄑h3 FЀel=UCJC(&3L*/>k q<47& ܙLVu7QK89f I1ڨE˧EVsV?ξoGY. ? 53Q/BE``d%=%o)NC(Zj:ٓ H+L1jNgx\l0fXJtZ)B\+Kl`e{Qy UO=2q"wX`"PvZ6Q絛+ݭ^̤qS/]i[IeXV~GB|J޽sG&eN@>݇Po5_5&}.o/DC=&J,5FђꐽKO=j*lA7z3]k'8tK,1UdšHzNvh,XMw a.MB#|_ʘ(nF'w{0|&8-@i?^R s >t061Hio_gk^x6 O-Ghz|0Ns6Q$#O5:QXvtaQ(Y9wl9u[^Y%r"X[O{4S[,uğ{OV[_zjhFźWI.}ډLREXzoP U%%fV =FC-:Q;aFN`bhiPAW6iMZ+Gkw HzlQ-~%.K&=UkZݒ?$B ȋk wIuy'`t_[0Bϵe@? ,xŖ3$(s(`.^w@,#*;ɾABFyLIUy?F0oA4Jb1H(sL$,:: B4CPR[lZ\DWŽ1gØVWӳwVgA=E-Npqo1ػƘaq?8ur8o=u_MEĠ=FSb %R*v%gUiw\7tK?1ZS"\QabCOziTB- %xlNWMٯJ:+:&7eLiO-i{@w@DxrYvn*ξ)}u+*f:Ph.yGNcP8$+&3<λD-da|"¿ɱβq X"8"Ac]Dj*~:4V@f{]$xEw4.d,,ͷt#iMUCxx< Bw0A eXk5d!< @ZaW󚙊h»]t-'r5ɞLܶew1։4ҵДx ?BWHs%RDdq.g쎶~[x&n DClg0P\ˍ||KK3ރmR',`L`w3qҼEdw )MY{dscV ̷L8 8ʅ^, Tvj>Q*hdyzsJh.Bu?X`jCK .${'qYJn%qQCnp m`F5\T9ζ}]xc~T bU7õQH9&BE{eV}񆍮ʫ~D5TISo<3]ZʲZa;K7-Ñ 2YBJ6-EڙR,A_U >]tH`A$N&ZRS?q*33@^C+k ;YF;0<ΛĦ6x۫U7!ÃIjE5Fhy4A#iٻ]bŋIDVяDR>x&XyAأTTEbd7ACW6lAz_A_T H9 .t1O K[+ttxgA2rIɂ'VPW5:fMLyB~I|29K<Ր3WZE3X eꬦХy@( n$l̳5KVNu6cl#L1V_O6Lh&@]x`J,Gx 4=όld 2DgxY!bCM \ #p$I*R/AӀQX\;՝2Cj̵kk&Ѓ݇(b_ݟg\pfr4n08n'U> q}raWW՞ǤKv&`\糙#E9v?L?V{7Q7 lhTy:Y \({JhĨٝy[s[% t "onv.~a|YtΑ&r=Vr<.":E %A#G,tu Rܞ5o>Z׫ ژ3!z'gF͸$: +VA x"0o,7Á$:&Rj:"z!ZvHfX'M贉`qt[ub?Rkhm d @)\HBnged2EtUn0|m_jzO=cii^wv^O#Y/X^5!:$ܨ̴-!D!1KKrQ˽z'Szې[[F0ɆZ[Y4ckE"Gs8Hy<Q>Vʌ~vdشEy>%S?6U Ϙq=9?k?@cg?_Q$2Nz|փ~`nfbt"٭lP? "3'wNz% w=u5/ 2,e~v|O,D!LyI(A`1E^Y<4:} 0b;i3i,1^hfhdwCuYfgomkW7s}">B4PC)0{`48O %X#Vyf(t RJ %Xq uvt1_hQ!o;RL䨸w߾H!#]`'lh% |2L)4(]$KHt&(pѫ8,o# 00axvM8?˽Xb'G)vr)K XeҜɚwA2Ga)7~nMc6E_u %T0ǒM QotŚwߧv(B D2LF[РK4pveI?2SI`GIiW5"p,? mm S3"lacdSrq2ܳ6vg!ypfPlb$&|T"t P WNNyNg؃IHp ;gdja'HTiPUqdp}~? 9]FYW"~4]}}TT=tU<;Ż>Bϯbt D]>Q+&d!YRng4>MN*4صPˆ4$J0gk8 (SKeW6_t[fJBމnǮˎH*1GB`,%fG;NR4B&_!"7Ks(V7 8H'/n'BMz{ɂXނ5U،d@:CUEaTO +%AV'eo>k{O#GKwlkV3M)Q$n,]6[s!U}$"a@ [Z73WZcpm}2l9c s|[M:wKd &w?P߂0H.n+KH-˫L-8%0^Mև>t {%0I7>ql/Yy?W\>iAj~Gibװ ڶt{z*HQ ϴ*Y]9f7i$oG8݆ocq$]3j7_8Ї7[9ۢ//}vRbt(HP:+M9*9e*` 3dՌ1>\Dq EvJPLz ]S5{/-9ᚌ⎩ .Q"u}~i~֩8"'Qad+|(ܼ-V&#}{Xi2:ОC۳ܸ%@+g䍽P)RreځS:?Ue^A\!^0qvl{R 'o&8?.(e-(?b6WUOn;wlܺXzǹ-v6=MUn`oPe1%V8OE kfuhep_ׄDeq9:g6~fkL LPixeoo!LL_HjMI?n@.{eя:"*VO,"._bekM;F20iOj?5\F.w_ 9y|24bjN +je"&hݚ A &~@jLF} 4ڴڨlnq2p^;[mN9xb6kI\-a_&#뤂v/죃'RCL˪NCm&F[}(q#dDsEF+hЀe<1 >"FC ?׾inf.7wybc ˀu&דu8Zo3P|`]Y&!w~ 3DgoV;o|A:oE>-Sl9qf$:!̮ D2!0ߤ$I#"+re u餹qrO@o 'K ߘvؽ▅iA3u>n,i~rmہ:cG#}I!<f ͱ1|˃[axܝs>4|וi OO5,nfwW9TZ@DT P0;EQv&^6qbv_F] MywJ֍rV9?LJ%6Wu1#h*Q}x?|zX+{?hΡ[3w]M}*}VRsn٢" 荧gaQ(E-*|}͌WlMO13J޳OqShGDG*BC?,)Ġ'4 m6-VUǗ}`}7M\oKMN$ley4LT?!\N o]^pA])yևum"jO.?l1TΦ]ȦsgCxnf CB'"VV iecRG4|,+!no~Q"Tix ^z'Үb}*T2jb7h)xzjǬh<Χx\~[GsJ]Ձp1 3%\ 7&|%NjTA~쉗Yt?:dAH=}a51:pD븀 +Wp C63EsܣE/ 0l Upw'c0gڣxk~쩹. Qv n[;crD( yƑUKb@kQ-F6WxF0n=\#"a)@UP>Y ( F[)tˣ2whˇ ,{tgڹ kǻ^.+^7D7;sm LYr͂Gڣǃ-Z 퀏Dk8\j։GfKDŽ "h) {tQ~w71+&*]tJ >R46r5.%$:&j9d)pz3lVGژ2-lfz S:@CKxd8]i w#IbOB܁!T-'8˨ = p~x#qـɜP'ҝ[zTqH[L 5\#VlGcwʜv%P*3y*3 Rl|^؜-y p0zw3՚y:sbTJi A UeeW%Oh]%Dޱ0*rVتm6L9pb;;)x4&a^j Zqm;桍7&V@F(9 ԊxaP!][,i^Cb\heF]9’B/}+$Q8)5Ϋz%C04BϑMK8KE n7'k{7DPSٮц;(V)P1Y(M1ҫbU*~ߎEĪ+v kg_i]X{L YW`F5C7UQev'۸fz?\lLX 3ߒ@iҦk$%a~-ûo$'G?T/ܭFf.oޞiZ f|${2VB3ϝu_T{WSpG"!yP}ߺpN5jټ턓Cȭ@E\o2U^%:Ӝƺd_>IFrm*:䶴As ~1ʹGKN@I"ifSʎCh 7|r6 bIyyƉ!2)`IX[YI:.ܹYlޖ ub'$_d$9d+x[eb:QTJ ͪ?_UPCPnE er1<5<彺:Ih&BX]R=}U{6yc7币@GԢ'3P0>W~&lcW 2*0i4[U28v9˞OُlU+b:Q;; U#em/مaԞCe1%l.\C]yq qbT@BN;Ϯ+piGح`aϧPp;Uowϲ8 6ޛlH#n"j*LQ,o)́~V`cG…ee4<~>ݓ^ >r$J`hI O3QG0(a:F'/H{3"ZKVcm6mr7㣉 %kc"4r]QԈĉ>7 lʛ) QcO:Y4vc (^ l7wrJPZT-*^%ntW#1'Yήojw! i$ ˜PF q_\3ly /֙S̄f^(yNOE)Js#j C7b>!bLO|52BGrf hI8{,FJ='T@5"29xjm .qP-U:aSvZiOb+^se!zXP<(~aԠ{ic p|Q@#CzI)XTF\=aOôȬ{;?QxGղ8nHͳE;009B}ıQ׳*k˭ Qh#&ʱn' d7#O_9voX8Ɣ.:GԓM5 ]و/Pԉc2])*q5ʠ𷳋(\8hNKAѽ{)dk8*h*vWW017FXa`ۍ[ZVf$8qoWdħ$`!1FE|rC[?v@Σ& * =R91'֓ U&A>8Gosq@dr")[ ӌU<^If|v:ߜ٦;ӧ1Eݚ]5ilƿ0HUsAKvN-V+u=^nTuxQ_*- "9ynua~C ,Ij_B/1кܜ,+f/pl 2 wUkSg #sÂp\/AR}uN5Mw%qpg9!#I.HG|n)XYx >_UmyzB'S3v5r!=0S;=U68tK2`1@]Ξ7&Bf2>gkS:f݁ fO/X]z;U6Q xafo bxÙa#l a}dϊ*{y:^-`?IҕշFv o<7k=?aS) z@^Ã~-^E(9lzb%+^+gVt(.^%ͭ\"쑢 >-FNLK A715Tjt጗i0ʲeh8#.3W~G(>Ͽی,hd]7ꢰ`j}g-k‘\7D`fsYDP!:LӏЖqxrr9hM8+eY\NhZ^zP?5mbZ]+XCg Tπ܃xX mZϸ*)N/1Q$)1 ^Im19eG3t;¥%iD6MW>WpWr/KdRTa+|²V+[DfYUVH-%XPE2N5VD!íR"(#k#7ɔYBSRpW&(Ŧ+34%fZȎ|#3Yaz~sjM^}y ι/?N*xחe`/Gj#Tt9$p8@ ݋ ׎?bsvSߘK҉|1{.ͺX#V~ɠ1$S[t{6[Ll0b5T .0efZmRɤuH>I]Ni )2uSb5%@I mi2U;zC_ۗ ^ ڠx?Q3: YU^ދ~HޱL{Mf߯Iq N+OMEWTSuo'<%q$~˙Mz)1bnvprИC0FD)!f0,B&Uo<5]I8Ւ39 u2 'CvoC 9BmbI=C:Y+̹)[%^ơ8tJhP0+s;2J#ap*쳒kK ɸ삲Lo;a}w 69= IٿfUaZ7f(\?cTSHAk#kffC:e7E34\2hTK:NJnA~?' 3ʑ ,/bK-ם3ݰ*)s25HBZ8)-Bτq$9x`nDgDrB%cb6l:-[A䓽//9 /c̘߆0P1u}oG+5JPfqM{Dl}{zC& gOQꯑ _L/WAlJ B~vvLvqxغT@ D&X/SCU\k3G3ѓ2h*V qeh1nSΜ!дB -O% # ^@Dw@OO_sU3qrnց笗5)=Y|tW 2e*W@ :a'.m0%Vk~am~8w:ٓ3P{"ȧ 2o/Qո*/vLߞ6;B㌎@;3`mfhQ6rƢkɘc/lo:;a4&OeLhUPcrؘ[:? K';`neI3"V2NT"}J* !QG3b:ꏹMdY-bӇa580F * "L㌀gZe"%3AlCdxΐ$W1Oկ$=FzNJaι=녎 amN6͠UT2{2&oHTknjj V[n^ }*]HSw'*)){6c͍E+e={-%(B٠'UU˫мW"xlŰryN<ڡ&|T1Rڒ_ S!zD[.8UP;lFvIAkUoAv)zda|)y_S.t݀ʛW'Ū&H;=UUqGe"yS;nUf@Ǐ\H`Odxo)[5wL`5'i*4|bF00# (C5[TH(6snn dn \U22M {3h>3I ~t!Em$kn"YPlٔg Yfh^,oi3fUs3;"EY<<\$:-+AJ{QV^Q7B2\^̍P g=HCh;w%5fvl龽Dyf:E ^#4ءK0f.]'bZ"&?~OQb+ ,{3 [Hv'I. O!9cȴh1oRl ^3W$ =Ömi{m6;>#fDׁؔ$ux(jb ~n)]UO9EYbDw2 Mt?[qe; @# 䴰Lf0Р1z)cs{x]؆Nk+Q83D4 |L!?yIUȏf(Nǭw?5`IRsZy:MAY~؛QHfpmwS* m4mQaQ]A*yI5#kہPe'[H.Sq SvRlYIw{er?VQʹ!\$ˤT-`Xx U-YzkLVŁ պ.fVy1 ޮ(~H3 XA-2ndV ]1!;ĵ2(Km[^_܍ 5<VJpKuךC!TF{w5ɛ}2lϧ4lXN[f`7<@kR@<ny빢^Y5oMobZ򡐧o+sO MDOi:Y3vx7tu "JRZ烜MT_q)' b61W gdc\}nF&Wq %rۻxdδ}ByM#!e$'rE@#L,Q 7-7cn T WpX!|#oz4/_!ףW +pzۤ\ R#9b b8))P5-PVvG:չ>d<" .93xܶ;{Cj< s" m i2nqЮo*Q 9˛&2RQQV$W|7 Tk%>RQAj!`5E-l'M-kd &KON@KP$2^/+EwQf-{=S)&RP SAIe}Mi&{:D2-b]/_2;52황O+ӌ+N H3+=##4 G@Q7g}!Kagcs:ʥʢo}_%`$^tVΈ0:=`H"Ē;Yj(fR,{7coutѤ BCu_5J# "ڰ՜>i,gh 8R`/0o5 d?,*,ͅ٣M_LlGX_%o 0 V9:nƶSnj'og~KߋP  YqW^8,>+p\=,B5DSYFKg~|ZXQx<ł01|G`]Wq.#~$ +P F0E62͙]x,\ ot"[yAZ|/a"6RPW7-s 0΍9d _fx2Ю7u@V*@,Ϡd(||EAh{ SH0ua$n]54ͷksYũʫ/a]oq.UW|jOka4uRvŰ6rI-x濧ciP2) RijxFS h`BPI®?z ^ Pfkp0Gĸps=3͂Bbȯt%bsMk/< ׂ,71'6刕kHԧ g&tizн%iV&hlyb:naFnCqJSw lV̉O 9eDPKelf b(+Nby3B5)y&lbG׽6.־0|BY.{zz ς a~!o,̖GVBK ea!iV^9wNq 2KO69>]کHT(/ ߜ|u12/: I0FkY(}mrt$.h%vOf'7 P$m9]kr" )3pW##ttޕrիVetPGs c=v@LW`ya všfY2:Gm4aõڎQ;:6^6C9O9AܞT9w?kxҁcv=ߦEOq.QF@Z2Ӵu1>^nN/sݛ|N_/y]hVĎ.<3;?~w Q|$M)6n[BKLlg9w-,2}]dK5@Qa!-< fKzcBJo}'pQΣ7= L }9D,iX]1_̓bV琙Ru#oW v*JI jR oiM#t;[]a跡|^OqխQ]ѩC:pR-٬hg:4%v;&d!,IcҐ@yJNi  ˢ&|Ag茁١Etu42Rh n'F~7ޜD%J\'i ^=kGf7G@_KX#inrxآ5zw ύ\f_s@&# רhK?P,,%77aD?L4^>(ǻ),;߼i5]_.eFa@h05F;oL}^ Z*q#9N+&m^Q =ٕmt@cA֛uzT7qRƥg~=IUİTV;TЫ] (4HMW?Oz"dr\[F'8$uo4ŵ Y< hV9b `vo_KG$`-< 4US8C$<\m~OE|_9Yq1r1<h IIcQtWՉĤL" WFF'= ã$o큪Eޓ_<Ӻ;g8k*< 8Ac\qMR5ʸ8{mmj⢄vNbZFʄȯ^hYIC޿^ i<%+ƜQ'dq_ɕ'@&~ $jv}2EX0E8OҔ)>c%@9&+>IpkgH d oIX}ۜq͎`EUH<`F㒚'nTC =v qIфWFtく6 KO@grX Ym2,-S2S!IiDQ_27< qD}L4m7>t/Ѓ{+tg8.dmC>˟%N}[} ?xZxKeK/D9^zQY$2=5f!g2v4玝bb(NZzO$w %r.5frRBZ/ӂ1k 9znq?|o~[dJRq3,8L.K%g}"mjsa7Od]11ɛxn|()6fRJ HAJkujem Ñ^Mg(ǘ$^1R6EuJ>d8s֪  Î>}Chd2^s#9}N^Xn9frw\SQURA֬&)g}M4] ݋'1)HkD\ٺO k3qC9FfXH1]xEjӞb{^H~+ˊl?xn= j9C y)%}ԒF4ä4Ēj;#q@hG׵s<)}ċ?en}S^@W3f{}"Ch68~ p*5[B7]҄K&FOs,>M3d@o5PEͮQ 9iDTI9lݜA=Ģ+EO!Q*]$=I@j.ha&o)Lw}-Jm_9֜=YxG೬v3q14P]jx1)^B:(Hb<;k€rgmgc{?O_\g)IaB$;i`:XTe'RCm(L - E.+#t#fHNj\ J52C-+A"Oi6 q͘iE2,o8}U˜]P^ qڑ'B }w3 zZ=V)YlȔ-gcTO20$s{x;q8mxjK,n]9Dan^4v(!ad4]F c |ɦr\ZqLt?a&L_P{Z8 ?/͉ז=Yhuzg>ܸ٤ PV pLھm\4,}-cHXL>s8`%9 #kYSVj kyؚD}CPI=%6e"4sS# V< ݒ.퓫@eR@рNPs"Kz YxN*6U}97qaHjNSx6yý nWLt}YA% AŔ%TtB|z0l?2)ǐg|ucR||#{jEjCuҭ) tȄCM==4*IY"gÇJɴeέ*[iYml3hDɌ tq͐@hq*Q(c0=# Xn(ќD (\2g`4_!Z]k uJ x{ ֳ>$=t)1:YC}u -֚[yS7 `sjG"@bdkTY{,ߏ!{kc^`G&?)8/FꦂV|)g͆D+4X%usڛ 띨QXdΰ0xt{q͓ꢺҙX5Ls*"g5^+77'Dg&\ۻ"Wj68WRdΞӉOuכ>s-N )÷IJ%]5<:ɸ{x0zd'cu*#r^4~Ѣ6h݉=.XJȯ"(x=~C/uTAt)9KKĕBJThzM7PÈ2joo9AOxxs&giVOVE>, /X?0y׷U"KDLە߲4*B`21%{ -oMfXG "OG:53 [%$ bb_yog !s '- |yICQDJ:01nGO<wtp: /lH&uR.n 8El%40$ e0[78;;BS1W-1uN!htzZ a%gkI2&-\NX4>F#h׈Pǒ(=Z30&ߥ>Hdmϼw7EkJtÞr6tvn"yU :ڜ{7$S9m䮹`Џs&Qdc\ېГ9'>tD"rD|?}tv|R9M.'YxN, ) fFx_V{/-vn+T"(}͹) @)^HURɰ) ku4x/[Ƭu{'{?"ID6 +9Z%/q>F@P\*0*LntZM焱HHi^ΤЊ;{r-qd۶*c_  kGV_(ݽx`Ćh>A鼲ȋr|,` Z(:; Û2ʡFh O8ܫGW:a_:ك_K{ۿӑ;dJ8r? wAG=2ED3Fku  }N6SZV0֩޴nlj8$]XxND1!&h9]ELK_tLXK[!]kW(n;?}v6E^"'`3V"(XՔ|2W9#Y# EїbǶGb6Og" S^5s֩׃X R .V! dIzBg6pWu$HiA&}dw^62A{OfjͱD^[| 'a>I@7tMA[d=3N Hݨ*]D<*_obV]}KqӲ%L6(Hnbet^`^MQ'D qhiY}6`1鹂M.~Ρl8\6$~Jw$D\b,,xb%nLL/ 0dB ӄj> ڥLH*Rv}[JDy,+]ẗ^V @ j憕AIpUjH+xyH./&AMa !Q ~<6N{rXSbSo^ \'ncc4?`Z)!E dy3K)"ʝmgB2B>s 1v");*+CWSޚ1ű#(wQhky 3x bm(˂Ɵ$%[E~7󝈑9y59Ѐ0-Zy#njosBL^ =w۞rh|{v`XM6(`U-׀Jf/aHA@QGr !&#LAz a#mu1~=pYYK x k4+}XFDp䩑(0BsLc%?A0ZlyŤRPc7~T6T \)!7ߊx-\_bZI瘟(9<"U fF&r ,.7RCM1Zd Y˪oLc#vv,T7Yiͭd7 >*Z#Q{֩EB\ȑk3**EJ'2%@MH1)$7)F@AiUn wж/gT65F<ȊXu!p$n#aAd)|Q冡t D)QX_۷٘^5K/M^_[һ䛴>oT/HS E-}a@Z­|ON.hYNiKƁFnSe{I%$-=! *T8=s)l A}SB/dov W7&(qI EWICEj0*w 7Qr`8f)@2b!x`F@RwstTP`h/fgZn+*ߖB ;sE¹Ⱦ_@jm sl fA6k(f)l#] j:`k d-5[ %A*$Íe=UC'Prۓm-=$&솗@u 4Yޥof6?T>%C_DwœW?nE#͞t.?[ f:G.>eE{WbD)KnT^f>ćenoAek](-s|°csF_Bƴ?~Kb vQ@ruF汓l(k4͟ ]/T͎c$ _<(ZQ)kY*:&7)tF6\WA2{q+˪/ϩjOB,N٣^汊MuGچ0jJ61 .AR oŋzxuE VFQRn?I_F)UڬCv ꪃ|»/AsEu(bD K/׏ԡ,-j́$V/O/?:~~-g?Q++KF,w@83W3Y)k`IT 29y<įSmf?2r:GaYqz_x~-@qV)X% n U'gﯸ2{WZS܃|w[;=ȂH\nwŭĚѩ윷zQkRÛ bܡ>ޖgE,zJV0TCPN{ұcsY6U<BMΝ\Fw u qWƑŌZ2T_8ۋ:mp"IW(bXJH|/, \cQFgɗ,yc ܉ +"԰TA\Gxcx$}湕2J ԤFr1чg+$ޔn&% Ǜ6Kp<28AIʋZ v@T--g`?߭UkzB$5 ̤A?I~m9S1Ii8̤rq ],PxcĜ׎!)4 Y'2R%; Tۤ-N%Q/f ?og-__v( WWbXW{`[Rŀdɝj{-3|fj7FSIϩN%?43#Sc|f,TD5^B@=@x&_ѡŅ\3Yg_ELF'E}w Y鬿V&ʩiY{,x)n/D|ji[0W LREcŹB5vNpE#+IaU"] &1HMMkc]p>v'x'aa:ϜlǗ]+q6^B/r ofX}Q)(&]lm倄i6ջ>ʉYDݠ|-OvJ~F}owLnZDɗiwѓ<7VW? >r@5sJs'"*:,ߪ B߿(dt 9UynL炒\Ac`tm ^y‹$+4WګpƉ6+ɍڙ&|q[r^؞m]#N;{j()9Z1iK BPF8[He(Ji $fD EBV*Cݒ\/d!e᷺~ wCXqFc[7cmf|}#5x}:ӫS=nD{lFP>94;Wgm#fPjVBƶu _5OD ޯ+|SMm+z7>׭=lX&1O=@*Q44P+WXx.o*K6Wo5rѬ;dc1+ ;㢛NO^]CAڱp+̷̹t sGpA$!.Nb:j/lYIZ)@/rycqENw@u6 ezȌUQ#qQe%? 42z'SoOvH{4{X"Ȉ>좿j-Wke2/5<)(pH 'd"|wIyk b^"HE<{,)irM`t@>\).zk0<^Q F'GJj)2Җ9"ڍ.^z]"}%`!Vv{8 G],8È+VIlM=RykeoA}jҌ XBNkY 0u&03$Q%=d=?TPZc]\faf+(W܉2e"&T oŌ/KH‡pAf~xQV\5D7E{Sqg`(fK\9 *?JM2lnf4Ko :Owީо;SU@uЕxNiɄX+'iJ`GL³`mO6:顨S;%꠪h 3,Gq< |C */8n: Dg 2[q3~rI/ZE*~m"i-po'XBJ_AjO<ڮ?Q2aO`oNbMp;שsI#YB)RQW,/̖+} >?E3t~ZK;Վ0O^Sgx*JӶ^3`'R#}u>*̠も KѝtwCwevOF! EPSn.n yDفQL|Q7s4}?Zw.AӐ]΃217 %i -+IF"#!1G3jkq!̸҄2KjfeʈE 푤jz+U g"U59uoݚ{4,T0bFq i61_E !Ose J?+"{ <ٯQe^>*$Mc g)"򿖿iM |ǁ [,)/~rc9 K(0V`&/qHoХT ?5M)7vxpب ilOC\}@}Ѳ7h'Bc"a7ފg頸 ;ݎ[o0g={O@վyGG\fO fx1Ve_F *;;bdLKV6Lr֘Ao-aڏdgt=hi8 f@Һ6XltGJrH^bʴvC_UB%HrϡaCa|&PCv4)2 5!m2`@wo{t_>Pܑ.S8( z>#Ei Zw+P9簛18,z3o J? qhjмDhIm|=n.]0?~> !&5F< 1ʥDJ¬%k,HPx+)$EGJU-l%vTIa^R`e^/ ? @.iZn<gQR3GY2Wb b'~.Lj55F z{+` !}'6VEz6^KɉJRk8W4F3fRH0Q3<_Bz^G76Xmv몬T+ݽ l@NAe;\W"r7ukT޵=LKfq̹0{C<.A`}n^mjojpux,/QVP% i ^mZZ~K9::<^\JpPߧı~!{ N' 1R#l6L;Pg3;uK5[̕g.0k?4fۡ#o>ũp"X\,)ES_̭lB5-B,"^Y P}]I$ĦD7ͪYՐn9[fA?*q|7]A âB0SWɀi!Q>HE&ߩפּ&VoM)[U6϶ ˖j&X$ 8Q{N+PIr9pWMLnSa&$h#;vsyr:~"H)ӟs?:ܝV1M:dLd`ul_GEH}kFvereл \ "UŸpɫʹ&#gΨ2E`JAR{#n>g\rTS +c!7T'D+5.*sx%3겪)1XJjvJ5{L]y] /qאX.Se2~FhLa,לw֋ ͐x^|M+d>-ձ ^65#^rQؠ\pډ:_R̆ 'xIs!jh,ct$u/^QpC&5PZSy̍R-i꤀'D!b҆H6Y:@,ڱa9Q=xQ<}H &^(_~b+G6Hh{F@K21ֻ(OXh)y2C{i"`Pj(YSDZuU4#DF6<|,uAp}w[W1s[P6H8j!F~M&$)h/a'$O":PC.9E-a47ZH\vvt5ΫSa:%f,'ޅ-l\\-ke`ϽZ ש܄LpU=l^Z#Q!Ѿ&uƗ@$SBJs@ALE^Pm.)?tj^frbtm\`/@W@R+f^$ށ_RA7&+zԟ9>~>4jIp;@Q g 9J '"ƒW``~xMYN]N3]W9d#&_PaiynW֫7{3 /NSQ|pF$Pk0,Y[ߺgqo[rVq!Q zNd 0u.dk2v;C4Yv+[֞9-Zz<.liRѺ6 {ySnTG]!MͼU}En`6 XAͦ{}Yb/A."n`%dvqd#>>W4L[SܰD09LE]\qF "߁^ /0;u*\ M]uz.~h^cP˯BԀ~Q=⹧j܊H,ĄS#<<mbn}miVGc{Ǿ֞T [CbVviRi‡>~Xr ɇO"|qQ1*f>l|+hqZ ݐB80`~qD% A|Ě)6mOe ̉7F[$>0h`=eVl+gU*~8&MDf_bḓ4.onV` e ̲ "@K m@DZBUxIIO TAk`X:5drz1LAW-eEQ͏zVsD{͔]|jK!/E +wH~Tf|dJ\iAxof^>&ngVW񌠋tH=d SAn=3Rezt75X @s%̋{*YR_pXxd 7# Ox0U "9՟RDTNݪƒ|2O!vƣ11~%.?xB8jq.fDfК كgfk)X51~)XeyŮ>p|z]ݯwB~kI`*KZ{l9gTu) YBGwx7s@X{,j%nwyFC≯ u/ @˖%t؏Wc ֩B^8lF*5{:r_oJVSJjQPJr[\0s,TfT It؞bwfY~ʫ!OZjd4\O+P-uس0f MnE^Oˢc8m#ZP R/W`)~+ )9 :ugbtjp1ڶWIIp c0kzտeoN덎-/- rE sGBH<8AwFku"{&<R00?G_Dӡ 7z"Ty 3v\t\fiU`?iBt5#9(LV kUpv9#p,}ִd(华'TX?bMeW092:$%mrqΌ20s'A?K!thqqx884"t(]F@HS𼿁пc~njE?Ѹ Ye:zֵ[Ď k#iiԿy;WZn˖b!lܖ6଱UjaBb&<3wHXMQ>x#oKXBbw 5< \ʆt(prYS.I~ gCh|VVg4|!m1BDK6F$D8R!#T I Ҡ94H kfy#lT7YN)Gԝsa;E:{<rk@K[E6}@SAîfp<n|?zXsWHRV3JPvrѽ/a_[e [EQRzNeUf%U߄p+sEB^GXa`KRhwlʴ ǿBuUB~`y#5rq**_ڐ"#To{!c?*d暻|6+%t3_#}Z6= xYq.7 R+4Bs8!\==Jk ݅oIbXXb < -rޡ`N^r eEo>,騇ls8g(9Cл/*%>,.f>cvZvnP v b~E9JS!u'~ZnFN dtc&F vj|Q#c6u(Dci UQy#bПxyy7o^rҶ7PiR@~f$ v^ze^+IBOמE#'4o;%Ũ7U߸mSQ[A;- S)u>ͫTPl8 6FBe{c^BWiQ+Fӫ*8T:ȇyvciojgc}8W ?qT"T9P~%i3 qɝm4I"B̼}ٞ>Р 3iC;dK eKVlA ' =)T &a0\"S./֐QcBK3_b\B @PuFw(PG5GlVcO ۥ:gPSGyxS$~U86C%De|H.WkݕxSt_,Hd *]&{ʠC 5f{LæW7;COJ$Nۗ2\<X\6a6ޏ_T-փ f4تrd:PļM<&q@)P1 >Hգd2¼_&D<'$b=g.+XyFg TC\w:+8oER; .F*'Qtb 2ٵS|`P1aHt&%ʷj.'{- 'plu%[Ij0: }w}%4ՊWөe ؒuq+z!&`uo#R` T5d9̞{^ȟ)[Q&di,n8R,ï ?,}0x>O#C9r :kᷟn0#F>矜XW VI%]_x! CQ+W[|OC YHF},oUdA@SsihOKgќX*H6RP{ʀzf•_֬[= 3k2B"흞rCB\\9?&l罁Ph .APEŅipJV@X=:3Q3~,[Kc9HInO!TI`o!=_V0dofR<wAHw~2]h01Dn~j'RgaC|w>(' 9^+ gfKz},H7kz?tu._%C-¼Y #`F4nݻbh1 zᮘz(]߶MjE`{h5ꥳQ ǹW6ip7_ E |u6ҌbJEt]7h(eȧP >o(`.X'PU⭫`L@* "i+(߻ϽVV>zfx \Hrr}W@:W\x82?Kf֝ ^#!|6\t:+tܶӚ(QV7,; Nq1 9+lnsػ32`:iƭ=/5q\()O#ϔ?`Jw)ta$%虌[1o[O.> CNH1tlJWl#P]¼k"B#w3 "fuńĎآXWB1bo]R.}VZj> [ۍ׹)u&/?Lˉ¨~fCwVcLTϭWOEFQagc.G[^ B%B?45PBUYwI0z"P,RN Z|4rW*OpS:hyR %s3 _40IE;odžl],""nu Fe7 %ę {^^m5ALPn;fчD>[j9rUMO2QfGv/A(O;YI^- -2JKD\OM07E]'=`=baҫ}Rwչ,qR0T$MQ@z{IxXaQJ# )u ?æxg^+dh9CYid0hԻ"é[O[v2  a ԩmIzҵo,M.MM8 ;S!!Rй]_TG¢O 4!JVMuN(nYuzB[6mȀQńa9Qer軿F ʝwYZbpQދ1J1Ym_Qy b;jh,ZXۺ-՚}=]iUqtT s϶s /0Qr#UDFǙ%`"/Z6@V2M j7H{caoKKU6fgk"|{G2w*4;0VlqXObZ:x^O{EM2aȬ*^.g˃f`%|M&L6܅!xk8' fIۗF۶.ew SS --{4N QYd:7%=A`TV9\c}[|7hմ#χc|n RE#s_BH`G ICΕ]t_ L* ]t Ff̸՗`HwA&Vn-G|[irGwWΏr=QMjE'arKzzo滢aAj'P^@}\^57|SQ2JQ @veK9Wf8K{M'fnPi k2\f$ ĖoЈھJ֠_,R8RyRBJlxztbWC7yr435jyTh<[ꇚ|d>[%Q8&KtH:N.P-R#s̶m\+9C(7fe]NsђbVԐפ/ Jb7'%P}4yh(m`eᖊͦ21&6Za p0GfɂnIP4L2m.#*ݍe)ǰ_x:?6;--" 8!.#0 6Ey;O0v(\O n=<eD` }H,k"Wi o|AO:CtK(W@2'c. $C& 9 ? '+֧܏DIZ)/-NjBєК: }QOlU(? ~;ބKsG$gD5|X nHo2?FҥNjis MŹҠ01 ^H;X`|3^ b\{cJv3%r԰CrOad[(cd1sl|J*^p̐e2X1{R= ݖNkju~Xg}I8pnh&R"D޷?& m3!ƛK4.YǃXW^!0<: -Rʿ> '}%zJgCu;w[ z8Í#e>p)lf&{>} Ȝ0 :Y"V.ve><ސp)576 Vut~1F*3tRgBrC Q$Ht KKsŘn] ɂg}juTA9ZN )q3کy>>̠(*}@Đ_ÏlɊ9Ww㞷u˫s5fui nLUzf1V7I[0}Zq+!.>0C4Qlf\b`PT 6f&#Ek8H80-I4НKV'Σ,5f6f|3c4l-j3l\&!wys#/_nky&lQ[~f1bO t$Xiod gZS'&}:ļ#Y_&3cy54ILZ}-Ʌb7DI> [f%_[{Xދiy_aAvPitx }P2CBVhcfX`unm[u s>k(|,de랸;,jnBdH2?F0/WԾr~ NAsqF`*x qDx_S[ `)*`=J#NQKHp(y^&FT/ O=!FωdN[:f8"Kr2%+y>ZОj^XI*,( @NFiwIiҰeYN^7`O¢#z=f 1ȹE^*tYE@I0t9Kms_&=4NǮ{O gT'_OH 0Oqv~8dDmuKBn8jw(`"\!uHbq)J]JCD)LԷn? PfSfx^0⊭^\WOJ>ĥV`g3rjڶ={e9.!dlU l4vg/g6h1+>mg9-8d(}ښC0au@oU7(}c>16r?R0cic~0\ROh`AĵhqzI]0?rzp0\2V&t"a#,f'!0p!5t$#Z42R 徯hUEK/'p#Od(~OAO&<<:VCcxBp"LcR Ks0jI6 7S2`SjZO,ORKߥn/7t4Eo*nvkqgޟ$² PݤXa߲߳EjR>V[/ ZyI7i--`TkROO*uM<q{}x "N JK?y'ssy*D NƒPxk j{qSz$Iwl >)=NQ 7$jw/+<w5bP;|{Z-<1:;G|ּYp1$(F荀q`< F~ɀ,ݧ8!=wKĊ thQ'avui(Sb tlQr);oW)X4AzfDe|~HM+s/Mk 6$zvBD9[zargQ?Cc˝]t3F}m"q'{ =0e d6dIԦ8M/@q䈴̬0Ssi\ m ][kȘնQ Cv3~6oH3bjV]Sdo "1Q[6_+NK.o}5jYޗw<߃ fv7{49tA`8If*)p{tNi+_e N뒿=¨ܥ32?WlUu:d{1uti#;H)1a]  jt4η+jsAg!nM)q.H6+Ʀ:7,ׁ85@!~kt2q£^Y?ivDx3t@dDmi2ti4~5BH_jxC#;F 95X_71ٵk6SGPE C=#vGĖ-ʎB{np/,f:HE a=g>\CҺXTfg&\RCSE%:sd9Vs'Hގ!'+k^>\y[cy#xYAGܡ>QHҺ]51ܒNM]\ɫ&.\8I6V>v:sK}܍ǖ!Nâ/Ȫ` D5 \π\1V岶Zg@B~KP]eFI[Q_vMGҶGƩ΁gY]X>CTVG!l"JNufMۡjj/8TԢ T; (!me-Iؑ䗏U nZ$2{;Ui um5,!_E&0ʅ(l/]hTiwgw.%9~BOBg* kdNHF?ށ(:F9{Pҵ>lt';/vDt .k,KJ;u\s7 kP X~SZؓa(ZVC'k#+Hk;T3bɹPQ;ٹ!}L>xR]n2:59n@_҇x"^YTKNq$%)v>Seʨ0;;Sg\1~"aZ'vIB$42Wݞe>on;Tj|X/{Wlq iR[#ψbg\fɗmwJSfOZ3uuBEYGmj Jޣk,Zجq)<~7ÑiH@ Mթjx7Sͳjz#ߟܓuQGDK Lߣ~:.V6@"+'^"aEZµGf5&k'l(AUaoVqpMjI $ ī6>-5^7!{g૪^ɺ =߃#^™G$JPi.B:>-;+zKt7 KiQo6^Ͼ|iثdKes7@rb< P ?OpW:@Z'1K_sx'zO(fˢ鴽G.pLieY4dOUI YT/Z,=H0e |yG'VjCIdShv_Ak']K[@mt R 7xz*GjW׃k)PІtFΣ\bͥo?Rطnef0${SHP$YX4ͧ ST9 ^yvZbд9 >h؁P#^54M݆-H#zmu kFۓ4POdY8EPiZKw֛ݺgICjQ/H؉/(+m>x<OGj\/6WܱRSFoܟGԅEf郕=:w|Ve^; 7oYfehПgۂSZEELQ}F WրdgH 8mWP1ƸIkw= W,T#{ 0@XaЖHkХ^k$n]ptԸK|+})?㏚!4E'3ϫ<+gz2Vm#_G hj>?F/髪jE=KYxVe $E&`'ϑu*Ȟr[%㊪VԘ^X)!{a'=3T׊^K=7}?2sC"5TM.'hJB̈́#[HTTHF留z YĬq3UB)C浈8EN6Uh,9/9A}QP:l֔nvUhP[umwKj7$jv[_6v`:[#>ԉ߈ Zԯb'4js.x h51Iuj¼Mȳ ͑_[{T LBH桬 =8а C>M?3}za'd똤46 Փ!z_k?Huy%/0EƢEi*V*FGk;o;vF~EVrzj؝$Ҫ:I7|CR49=^\p*.&њ16K:Y%$f5CPgۍl\5,6@)*Ɇ!B+3Ы mo*ǍZH⑜DtI.y ޡJ_$򁈃2II\|{h~!~PdV c tZE RP[Q)`70dZIG[gt>ev5KYi3uKnTOʰՏw( ? &0`4ox` Y1'i5]1}ۉ8\ @W^[)G!0u=v`&DIm wrx /-GnuGi"*tiUȵ2R&[lj.pƾo_*A}ܭkT@L!ͱ.4+ U74/v*OZ4*͟Cd-A0/}i=@Pv \LL7-(hg[ Aw72;4\>ؤ> @~/cp7"{8+1#894˽woYY]U[w,H'pJ+݄hʐܺZwhǏsq}ꭑەO *aV/€rݢ4D˜*n]¢SVQǑ~ba,Hw({c"0 96f6"2ZQw)z=\, kv2p M3ܺz3=d|1yx¯v]u7[\*@4x5v-5bP QBS`S*9.)f7x}E&ӴVȀA#:o"ncCSSI=ߗ'm2q3F=itL^2K0[u!uiGK8NxϹ-|M]3;]DQ_auH@F+g'.Mm=q#x,os{2]s?$QH e}0B!b[&c#윕qyXf"FIs8P^#s(泸eυh}xWh(2D^#Rx8&'#JdJR /kd~'LrH\eIՕmr|ow5Ϫ*j2X_<5&_i+P1LyFJVb8չfp ɌfWW;ADbOMd(X_AX5nEQX[AmQ5P$lG6Fߧ3Fr.96KWԭJwg.|DQZc屒ab^miWrex)Lr> uMӹ_D$QG Z T!._lʧH64]F@ugd=k[*9n99g̅+B#pSx-krZeuw\_H#ږ'[,.%8_W}$&yEQx1ȌV]uCc%$"9f\xP OC2cP/ -fytȽ/؈vv>J'7u CU7{EeC0L ͓s[bF> QqC>n{q2Oa;ҟ\tBSwkB4Sڷu\#ΦK6]yń:r(tV^!v7c<1Rqzszr #_P WJ*QesϷE/<##Y SGBNΞNmF Lh>Y9=. fk)۱iCwc e=9xd I8ęz9q{Z@HDB7)S›(?ˍT?c8Eno CI/[l_>O|^@fYTÚ֢L/7]oW/ýh9Pv{񰒑{ˇ7"< Nw)sq$V-DsV:Ef?iƼNbg.]^݁M#ɣoU\ C9x`qbb΅M+L8`OM0&I;ѪZyK*Sv~YiqSWpW(ID`b`q0l}?;,m& . ,${$M#Ԓ[qC+ ˂9 zn!olK\YqoG ^F pnaTَD"re J M$^bX @9ԍr+J\ dpgğYock55ǘk*A\@SoN~y1AOC}~Pc?vW_X]6=ŖT`=1H5nŨ؆bwϝr[TxCg--d%lC)`}Cg&>nk_N߽;S׼^ 3Z `6 E7{;E6\jYUӖ4f(yL'HB|tTUūƥ"HS]Fec:?r=U/;&~'fLGDeOMJcϮ8כ6u34cE.?d:R4ﵘuxА'L(F@^42hs4 j L t6HI%gkl|( Q0;x$g?]I;#:.:Y)lXIpj,uhy_îF ]V"GXIыp;N&r;Gq )򑨍vG+c8‰5lfя+n[ꡈTX,n= u&e炃G;'>e"-NHcFi 螚b6:mb_4⿟AXg؍$P?#EX%SK1EN;V|42ON| ܗA#H#ݞV`F9{lci]X8?7h?dӅa_Wdo*\X8cE!nF|4$a~<)? L TzM)KC%uش-̞R_)+ю}gƱ,~ >m=Fª|ޗbbE0h $n6FɃ!@aPq/#[YC?A|$>y`:1>i*Uy/qB Z}$N6,X% ˇ=.vǙf:(AOPP_}bWMv66hW1)5eǐea]3|^Vs/gGL"Z4H%h!m_J/UǛL-u/b-o)YXIn%XL(.z-@d >2q'CݘI&]b${}4+QoGkȁ:SO"S&Z(j*ݧ(MvC,I Xz G^U_*}1R6`IC^w۱zy"d!=ؚZd4%vTյΞg^msdZ[|f^6.Q ʘ,ޝ6\͇ :o|Ẑ;~G:x 0߆:k9db7Ong57.\ ({8 xWZM5ݤA/\Guo~f_2õIxJw8}=Ņ!WȐs@= ڋZ. YWͫnsDG svQ;XdG\tdWZ)2/mXc\wւ,e5#R$V5O@ڿt,҂ͯAĻJCSnր(17;REy,bЦi8(ҺWuԠN6.N:O}jl1#cGc{X 5vKԪM;*dDfOiDqchY6:}Չ;s'G>gayELZ-j? ïQQѹA#Ȓ.@ަ9+##8tKP|d7=ꈨZ&kQϡVw@u}XWr ˨ XviJK"=эT6bISķ@e FYD [`C20-KM09F…C#m!q-x/u stx=K;`F%1^IωVGϒE@Un-u#KXs+ֻv#i<pE֣5#eip@ώ Cs''T,Sx*"J|V4+GfA&h󝚷,gbJ!aЭ;6pr^xȜtVUฒYt!d%} qZqZ{2Pyp_eE'%K1_)NqV Kd)&ԑ~S1}O?|LYl\^8ݼUI\"2Wxcz=ng-/MsH[{Wupy;3Y>/?EFߩ3=xb;$LX2T~AF&|Ls7~?y ϟW ǥ.sx[0W4ï)x@з]<ȶu+=QVA6d%>Mt2(׽\ҹQjBM"YûkT$PJawrx6$N=ZǜM8EѠg V{o}o3/S80EԧZ `yxENfS[ ^0W[O */CXqw&T,RӺW"fdb"4f?wFH%NqQϢQarr`(l,2 x1Դ8j*Vf D9 @.Z8,ڇA k?)WT{ cv (bDIm:N*zcH!-]DӢ]M&X)@Wg(L%ZE4ly(Pb=δEi+Bly~mj}{.DF1{vfeܒJP7 mTcH40wh4m7#8"4j4ޅ'F*ShّZdetc6Y4BO([wX_ '>yKmDR {LQc*> V<&׬]H6B3M:@u,5 t M+8װwi^\RNK0״ q:Kk n&J|UwV1/s8NYY-9ʕW+Op~w?G}LH"ٰ *[B&޻uk:ThOԐ}Hbu2mJcBBꙈ}7s>= ^LRG F}B#ף1,S)rOhV)=2oB9ð=DE"&F=&B݊3*7N3Н G/y<ʜE <3q">*)o:{WsM=f +#f5!LD(m/|5G+/~Uw<: ;w,^!֖Y1x_E ,s!.W9[ ,Z8]1JktJnUS$yRdZzi0QfA(Y9tdbUgҘ/9n@^do lH{ CYH{1)5g4rDDR ~ge8'Jl&Pf=@\rd6Z%ݖ%sAXbVU<ѲE*ekA@wu\Rwi6U}!R0<2mb4A#{RK~6q9ON= !ma33Ck#o>Lxs5 7aF t)tO mOz!1ZخZrksfat*3ßE~A= y2zt2ZvmػVHk8(TY`Z8v=gn`XR,Yݣ]jݚR;S)CaiwB4wkx/[QvvO2A6bZQg4‟pkC/krX{\e!׉Wc*vQe$ˇ ^l`O&@3/v17VnضI?_VTcX(B:βxhҡTt10L 5`=f(\YnL{Yɕj?(Yqk'֨!㔵n ,_"i%<,8l(Jfsc F؇#Df<͘# ís$ozethG)A /eJ^t(9Y)EШyĪ U:vܸ|o?B0 Ez\=.S%190%Kh>b1ES. XbnuUhvϒjǓoh.˥K+ ~Dq.|%<[o#_99 dO6thϏPʵ"{V^Ϭ &G;Oo S,k"h4E@(F%Q繻՜Y͎mTԫozZ+O$g&(ي!. @eOwXߢCPowXAIۡ MU_WeW3Q_2BƓUaGN :!S*S*=؁} #ҬeN>tdIm>nHPs|*[>""*QցLj[R|TK*ee&.0!5J '< 9UG;C0#? d|1gIvtw1:C$ -Z7oqRNR~s#MwC3j?U!م*$POVz]4Fߜ+u_z20xX)4qE*dxJG69kI=xnEo$ Ÿ=<#b3h3Z/€HPzM9UpbiZx^ uͯLs-><1%EXƣx`RylC~R5=fogYcUu9M_>@{h|Q6QNq7|>f6Y@CXߟX{+aUċ4KCa| >-tpW0F8 >_kefeT+vCm[]gpUNT3taZ6tʯ !uПտ$fTcX;k4/'~ݶѻt28}3EdE c>{ {1@Q)Iy@9gԖKe hT\ ?X];/S=*O_!95ZY(g G'Ԩ䂌#h`%R@pU6e-/>{ H.1­+\vKdN΍Čd6Yy d?#xN`&*N77tp,AJ -MgQ5@r*QHps&1GΰUAu4?g(%5;VJ`8?9= 3Si/SLO<$dZeZ*ɝA'˷Rst>F\ 8d]na1!>@u8czx&'ފZDud-9/Ve vNJ(66vChXsfc:/Wmw@+B>~LMxFGHH1Q3>aIsdwR` kÖAq*,JpN3O` Y7)Sg ZW\*DZKrj8f.׼(;4HAᱬBuDMe"9gv0,#dȽo ^,&U&C ̡T B6%]͖c`דq,Ț3e׭7Re&pQ% ƢBfY @Lu3۽84W&1aY udhAY7^Y:CD`(]` a/R2P #W/ BrV;ں3Q V Y5RVz>.(1M9k ?b ]AZT#E3xnU^Zkʲز'KN/<KEEM)mvp mٲ%)YX9ֿy/HC[_YZM)4&=)c}tgRDF7ҪxMm8@Lw5Aj [\SnJYRa}U\\gC%G}ŶWޓ,Kr*z ~WP?FwKis: ^JERp!ܭQp&NyӣfBz|*Q[dx6+yiy6r`Wo@>X.O{y9;9eH;iW*$ qV(ڴxg`Oc2A'֙{3mׁSTfg Ҝ;GWS!9ۻ֕0dU#*=4,%::g} S:OA'S!0ͭ/Y:RuPMHG̒⣍bUe2g36Fkcjz6A `4u(#}#i! j$QD2[J} I*!:\p~H~zƶG2͆ב{ohlfC9=d>resMBH8E(Ap5mҨ⑧^ >;q\?sXǹs'm sצáV<sjwuF= 1'u|IkY3rZz_oWK%`=,5-dFnJc~),J@̉_Fg$s* lаއRu8`Rtw#'h>b=Ks<$ kHXO]2D&x"/,I[]N-Dnoq iDx~W ok8NOҸp{xD7p[-pM_eI= V61ۉLh*mF//] "MU,Nh_DKIofwmFNTUaqe+aOaoܓY I }^y_wװ|!h䥎p w3ZQ :/aLFa7t3hxxMewjGӪA8ŠzP!k7N4ѯSIzqOѤdn2"*;lOR`$̢&CR40z(+e!BaHVEUmTvZl Ȱy#%@.hѥN,4khe 352 ~7t׺7MF;)=o]q 08YS/}˴[1|Z_2D̜|$C["J/N|.f`Ve1 Gˣk>~]d1E%-K]_?l&F0n1PG?4O/zE;I4ۀ_=Ws|mzM^RMB`X@ą05|Wvr>[go,'v,n ̦"CWjx䤣dTjQ/==rIG;&קޛ rpkI𮝊UZ-p# HT_[3鰂3Řyo-4UIAK`nK=G,QD>(: b}~Ņ냋,ҡjZ bjabf/$Z;T&r<{ָ_ 7iU}[_Pys?0&l3zlph߂u~i` u԰ɱbg;l/:/bKEl)/f#*ǐqetƬF !K{a&T"GSϢ1GZV8ZAs/g`t C~`,{H~\uxcdz, xr捌gף.ଶuVhԇ ?<)*JEv^ۅ%Z,j"{ @-ٞ鎧Ri֝ kuZH|?{z! ӃШu; H-faB CCQ8Z O 3@y Sʶ9):=!"/+y=ږV4כ bϫOc}_[ۭt1NàId[C?cG3^-Dm8,4H42$بoeޑU55M](&FYnCaР\#@~uHay{HK>n]t &]P.Q=~л72]-2c/9ܜ\%CN.\#;My\;YQ]upz˶N0j:4]@ Idx "XmB!VWV'MG4Yqk;FK*^ 3"X[ x{"WU!2ZPJ g$j,CоLG^GÚ_n~_Lx+J&OIY%=P19(^٘ h2}3摺oG˗+5gKT9.9_>-͂g / n8C(R|PGxp4N'_}D0/~22!tcwSC ֭`c`6 N^kI1٢2n}&zVrZ472$G5InrTO%܆L`?Au 5Wpj8v֭[0nv$Ԓ&Sxa)ϚC \Y[} wˎC7Ih89~n!G6UJډ93<`9Ȏ됛Mxdh=r04p ϼ)RtQ،S 1;6}WE$.4aO=7Q;FƂ9 BX\ͨC^b72;Ԝof@Pcdd ʨ1WMܽWIsb& Wglbypl~x(dvwav2U$VA 2:+W3SQj?KscR}@f_lgThCu ɮXVa|?^CQ|_6gLY33nOpA`[6;voˉeQ v%6x-Gb[r9#tTI3,"?%؞=Q.8s/;ݍ&|n7y)u%[I 8 _'j1SOKq'yuR,[.-?Pn/h`^v;f]{zA&9#鑥 [)Kh%a"[?ZeK~*NhyH|+; pZ;S̪){G¡aEۉki䨐^WxXs1НM2۾s@T«8: hK \{WJ7{ӂp]{ǑtGQb]3/˴8H}= kR:`#Cnx Mr5{#kV=bƶF`"{ho!Вnq^WvL?4)-~:~d)tit@?`̇8`^N?ҍ9N {xsi`B虸HFR=ĀR#Th5ߤ#`5>Gm4T Ԉm9HS7?^1{$WAGiy0Q{2ઑV(Tk.8Aa{0b#zQ?䆁$*B.:D%/PɂGAtd޿|F{aɹr}3i=Q;z(AR\b(=ʴs*hCBH cJpZGN1D޺7uWI 'H(ۼE3LE>{PH 8 L0s@J)1zؽ7$/ M:_MJ>~JE*yW#ZarJK'?%?L7W[["ց)Xa7ݟ^W&+xŊ' F#)B8c\DŒ\bew.0Z0 -ffwT?\ōMO2G5Y w{`IctJhZQ) p8΢vɀ G93qA [k IlZ6YE}Z$9Oҧ) Q+- 3Lpv3KUwggA4BM Y 9*Hf rpRnCX'̗ FtҲXMS!Z[*oOϪ0 ,nhYd^`Z_5RZ㪍=mf;J[~7(bK<Y.b/o?馾,mE`o'%UǟEO0Q>S6#E6`MZ&mh ˹nź![A>(Icx }1cq|<M4q\ĦTPse*\߂[9=Fw+|t#4R4&rr}UD8Ban ] e6c‹c~'w|N"0%S}ma'DvZ7TQZ HZ76)mמKdk^n~,ޢ$ᐕvݡ_X_O)ݜ.ЙVg ,>!@L.} ZqAېu-?l gl.ܗt  ej>LT"MsJUO$&2QxM2YBbg 2CMm؜oi,y@ȏ ( @ aoۘjS#题~ j z7"i)SxoSx [6 tl({p%?7BiЌtP rZNf˺ISkM|CLS\"ϗ$&Y.tN.RnÔgNo)evv/E W ЅAv緙A3C,zǽn.%*Zz¸#q6Q爲`nMet!]xlr]>K+!a iק }%`DVY"BIߣ ]ôqLy%0[/D/|הaCt"vp)6P&d*?n,qQ/aTWEv?P jCy#mGjNJՏ39YɄe֨C4<(1yѮ&zUr姡OyvoFgC3v܌_ۃe'$a|Odxl d x47l@W3krJjHȲ 1aȓ0W0tsUwG_6zZ\t;#vkANxB3;}&a*p+f@c6.N>]5coςh]J.ᷔ9Xx0JDgm5CUf9#(QbГd0Rˀ[QFS4L.܎)"[v; 'N !Rq w`^?} T H pOuc egUcw #B)A |;C?oq IA+.[vG)SKfx:=9xe\@ɸqR#ĵ:&>G.o\nGiW]a~%vSAک蚪Q%ޥ;}@5 `xK<{UN2]](&qe`jN6|o^ԒU#W95xѤ-uwPҸ`VqQtXCyjSTPը ԅXL&r(Gl>_ByE丙|diU%=T rzKx;G.Obu/L/-wZ)$XI{Nϓq!㇐Gc?kZ [H]cEJ^ݜ[A\;ͺ]Uhb,@b(*-d{u|5s T镻 >9A[HM@ŵ) f\SDF̻~ce8&PBJ]Cto ("W'eOCfxssjr{=9.:5'sB0.Lf;90W pl !exS5w6GN*|fjmPbB-Nõ`ۥrv"1qLf~HSpb'lxH' 5Nzzm /\Ue25qx&P_EzR Fsoa܂2<y63-8@- emoH%0PoTQ#a#yBRQ[tD}@E |6nI߀EAdbڪ$6>SgCw(jpb];746yt1 MEyVhoU^q5KMjOM[ê n~t;ò|ųFrHۅficql娅7M`[#@!%sPFyZ˙s\R j\Vd5b2בV AV*p3 \CYY瓛Db]%&&x✎B ܥ*vՁ=y,ې+{˪CVy(DL^ + #4%l8_80EnLhp[m[[V,d8cH332` 6xw./Kai ޵!0kO如 AGesccYDGܖJ9X6'70w'Halc&V ?PԿo)li c®W8`f: 89^Uʞܾ>tI(_c'/#,v,N+Lʵ<+U {.B.:H5b̅>L.tM$qe'fVn%3ygI^˦`ǻi.!aDxh1jibqT (i9RO\ >91PJ]/s:8F@c&-O)r<8[(q= ='>I<>]K5uSB} DWnvRB,@~F==Eߞ|YJiFe,FԨӮc& ._QOc y^ݽyAf@ɦ<A/Tsq cTWu[`DO6$̪*١}od̀ݬ㸑7BS[ ΍A(]6F[FOd2+싸^qt.ЄhL/u]ފ{gHy6U›у',ceJD Yy{LvRh`gm,q.a9]ߜ6`IG) }ήeL)AL 0n;-pX;o:0eߵc`[%Sp46L&q_;B|!r~lj ]Z , 8>ҐUfyo 1!q`0:y)7:q~j2b=fcd2,rxWJ0nzʰ?7~.ÑZsDi$_j\ :u N\(23e}$\!Ɏ؈>L#ZӜGT_h:"4Юyey]0DYCt2DQgF¿hMPu1!uf-55ɮ!9Nspd W)VYuǿq,&/i\Pi%hfK2'|j&d#M6[mpf+ qeȎH:s끡fpRS4@|M{Hެ)ܰ+KBr])o,5HY7`M.ϛ@@ԯzի32 l =pғZYB**` EotA/iE "b 䃭 E}d\K],cTG΋L_pO\LތYILD$uuZF)xYh+iŕ)SMGء`7acO/a/8Xt?].P.?E:XP¯Xׂ 9l؋}-O/]_.Äwh6A.q|b dU$Jsr *ʨ,LG-LDם7M-\*(``"6mKTFo&n@v߾c]0;dҤh;MA6':^5E_߬!|9' M6l+@&P;>0qi>̬dkRƍ qQx@RP}*ک^k?ݵ6oƃ$3w@ V*ZPxbR$CÎb^Rc)}`Ⱦ} `nbTR2GCsgOHI""ҥlE5Tw hIHi- O[gMȂOϠx6_=e=ـ oZw C՟'[sZj JC> #Ys1ԗj`8w N3i]⃊”)^2t9#3 AK78#0:|m횿! X>>i1_wra93ܱ;mഓ̷*faϚ(nX~H#I-J&Lvx?#a+Usk5aCN V`Tt*vܢL736TaLXrsxq(nS Q,S>ɠw{Yp$:/r/E߁c#R>,O6հEoo[lzҹ^ cIg;󱠀NFkiNgώr pBgUkwSc!ďe[K]B#L ;& !M-;BLQ಑#2Kf&:Bw1)jG\slXq)5be3.G*, ey|E 7WMnV>DSC65eJ=b{錨DZ,YԻy[ tҴx6wnEC&]m;kjLfB_S#v3C9<c -ĵAёLj0N4O&:i1 a_Q!|Dlk h)A;{G›43CTsJ#gE5>GSҡY"b%tشip4L9s0'6oaPp oO}Eq<Ƀ!y^dZOB)q.}'~s!iIպEKrCBu{˘d'O^[Av4_߭!uw+vQɽOapHZ7tm 'VS2bP?nnm~_Yya Rmj~m`lX`-h[Sɑrit?9Z;'TsB} 't|y֣tA 4) ISxdJ,äP\N49ժ긭]ooM~g8851] bi^X~OL.Q^$] l%H/X$ V0}\*ۣNM-aMNZAȒI!8CSyŌ\?lsC&'[ub GŃ }1`;VU ch@W*[uGSezx:h u1ڬ el%OI4#5Fݼv"x䊖6=֦;M[N{~@** YerHƮdbzT/7"Cn/e{D|MX殰 N~& >da>2@wulwܗ́?Aer0LWM4q} S4 Ih)N|eÍq(Vt%Y$ޙtuK;PB[罆3C)*gLqg2Z_RE@Z[Xj{? X}cnlBT,ߓ ~oDAr)@!zo'~w>ܚpSxг_ϋ/;)>0GܜFWN#u&O?Bpƕ0>x!DGv ?ov= Pg眨Aܲ*71;A萱_܊;r?z1pmhG,T)mh8VwSN[(I6e PdE $;X7y L^Q&rP*yA#v̆eЋ2;.\(`ku7튭O ީ|z"J'sZ`3 BٚԬv3i:O:lIqiNSlG, d YBSsҊ0` 2Q AſpYV63ͻz1dpJOYPhW!;i/eev Mɋt';9=.u FOv /h=sLVJx#~ULwuטr 2vZ̑%zI/ac!b9` hjE PFe]QC~7&+{w3<@59T]*N~X\ō{q *ZNXN(>yZSE{=$ "QX)\dاluș$hjuʼo7_#$V{%1kk/&IG-:)sv2sOYF) 'sdCvE\Jy7\"d5>SRgB-{kW %Cg%5nNu ư.G] ?~f@>{bldK^NpGа5߷r_4!ಒ8|}'{S:\ؔJzM_%{ ^la@ƞ= 3+Z +wD߈*XadVZ(c~4[s, 19Img$1qenaRoX>|w-`Lvx {4߮J\1U7[ĸV96Է -}wkz8Y%b󺙉XϽ1٪zCdT3]sR0@?@Vֹ u7\s#c"Sp// !Y٭(&;hSXw!zmcPT"{Eۚ2hdGL[ꪗ@Ho%X"mTu{<Bt͝r+,qY&Ё^z,mW(MC4gs;} ө0Q/Ӫi.98R~QK038]X9<*p(0bd3(IBbz(BA~H[VvKLq)GHG2})ښ-+ AW#̯6؄_-UꚇJADLЇzHb~/r!~SG4I;M ezQCNiQhs]D!;ozxD~g?4tt;`@ /JֿPj,DZ+s3}[/\+QU/"OI+6P (Ձol;;◁6KD,YK:DHuHtN40*59򅡟>TQCM[RK9C pkfu7yY|)Ax=aUòEF,$k"%v%ŒÀ:?Kwdmkgb"[P$]צAg155;(=UYè?ᅚi!O ڶbf~ЭQ WK5 i(udp~HHwؽpZKw B&=n_v  1D"6 16D] VF_'e+Hn9] ?=$gb mmSRژr^'ϔrz]r.wʒejZ ^K:F)@Ɗ)WE *zC) `\OGcf([?O?8x+ex>. Q;99& ?zM%tkB5[8-uy$Z5&kV`Nrb;OLnao/[/`<>06joꑐW=@|_CvBJ5*a3ͱl%L?)(n\&e>h|on"HSߚG -ҡ>cZxGMQ."<\ 38XO_-BHoDj5vF:Gh6/d:qx,Nv<MzRnl Zs{VN5;k8VRl<Mz1NFp}YF%o$Yc( ʿ[mxJ2Ev 5.LˆY?r| sFڇ71]SAWBnЭ5khF=QKdeCSHO/4.#p`^ 1^CF:D<Փu%׽猛WP 8QR_ﭔC g *IBuxq~M;(FTU~yoXF7)=zCün^wqZ9ͮ ^-*X?x ǽO3ck#SZH*72(3ϗ~,_NdxÝGLuY{5ݾwEqB$dU8T"?܃gF\v t0{B0:romZɪw>JSG`_5H7^lˉvP< |~#'-X'cEMw*:}A<o.,]7-3mYŦA3^sJR9wd=1mx6”U?Ь Af:ç.q([ӶR[:[i4Ğq`[,aרf5$R5~S"gżJifuVk/J#rԊ~:n&,\M>qZ D$m"&COpzrFIIv=k̠Ξ%? *L цd%ϧA"0"'~dj,Cu Qn [FC6K/d_kvt-\rzsQ2Zi y9CCBAGg>!0j$KK?K$T0VU'ښ^'FHԙ:'5; /Q2QzMM8:;P$o4;VM2\oTz0W,"bRciI9i"| N1B7& PnU"7J'r$lK)-Я,ݲEe$k:31/똴H>Q)hk?Zebshq^\=w@D[ LǶqG(1Z; 0(u$\2o@0C2 . {L߽^/'ѹk~y\ yQ除STI)_]pBNV6!C!f߸&S.1!*ֱ@O1+X4Ju*PuFѻ1=u\;Gś! !mj:Ԏi^uA4J!"d3Fg,M! 5썑}zP(אfs8vp=#{U|m4\ @@ڃv<l/>Żq9Q)nDBP.$Qߠw90'InJ5pd&M S .p7ק.9 ޝFJdaO~Ϲɟ$mE'1 u7TPs nb\<50>PPꁰDj%=fEbD0p3ZsWm{@m-]h8{z UoJ V1f-MVfAC9ƞq4C_Smr$7mJw׏ķ37[jx΂|KfG?6nt I-Eq |xZZ5>H9fry.4r5^400jo U\iK*y*Έîk( h^BM og1Ԑojfrl|mNP?_gEhL0J:PXǎH28+ #XZX݀pCg;IN}i/?A7ӅOMgϩєԺ >(v,6 z|덕I*j0ix#⦔v&5p [T)%#< sd0 a!oLEHƞ8luU4 ~ӊ'м@1j5KghaH?PLP9eR L0|؟Տ_FBu%?S!V6#>`fmJ NpK_n2,yBnӯy 8u!K=AYM<-KKq"w m"v)1gf,}>n [6 :7lWڌpX0pwԖ~C쀌ȭj@?p;;>O9Ok F(Bmը&0}x0[Uw#| Cڑ!zhw`sMձlʽC*.n?橶D|N+U~d[oԚ ړd=)EהW}/:o ފayWm ?ŜzT . \@W7r0uy0Y*: urV/7lX'k"'̏ՂN)e.F^(SızVG/ftgS #Im, S;< xӜG(j `ŋ_ _@a%Y@ GbY Lyyf'FR S6׷z{θ/-V| N5}fӠ1TX> 3ay?|/{96xؓRSqR0S)82PyWRyc&N1꺴֐yt2ҍKbU.-ӡ04 ms<H⎨hLyb v-~1⌫S,& dqNsѣ]7?IJL~Z@5զݹ+̼w%>'t#pM@X[!:<;(ZCMƹW+#Վ[:B "ܩ`TςED^P:,_/m8qb~YnSMܱޜj92~!?ԥY ӜwfEI VuR f%(o]l!ap/+qyAyF'zq#TJHnj²1}/GH&HRCnQ+\% '1Ye8c!OG;IN0f+eMjw7=&IN"O;EK׎ *'=&Tt/bF[YXQ)6c~%| gtp w'ahiA ݾ01 vqnp7EM(|3aMUXpW$rZށtAI9=\?2 㾥 DXjPbX9R4 ^ JbL4 U8w=UrtjIxOzK)H63.Y8KYY6jҙE '2CNMt%9pȚnɝRگyV%l:p ~5 -*nÄhHJׄ Rڈk ff10pJp{L|Vo#n hɦl&C)gx&A8Qw)=jH>_Dw_G9/ަM9?/j= !{ T&[(zޗeV|S{򉴞{{Au֛ BԪl5U{2Y3*{;IxzT_"Wt:.jy+Q%qoLYU'˯Vw[Ƌ, :Ie,ŤR0ى"gcx1BLc|[ 9j i `r_gmu[kG:UD'K*TCY]\~ LSM/(y+S}+uѝI7ѺϩC`;qv3,(jA'(aDDMX35ΒЪ%d<cj; "^n0gx+4kMe/*  C%v# IX)euzіe!.,ǔ@p!ĹN?gR,:uA4'b]5oP <$ʙ7HXQT#k ZR`}>׏U;pEsHY73.[\3_V =,6`9w\-\8Dxɮ '  דcOi8P:p>XS%-˟P7F#;@jz a$r) iH);y |jJU3=0 U5 HMgQ(TEPr7jkkiֺq9X>L({; U!fc@ROuN3iPGS-`D+2pkg%ͣ?[~3 ENqF~nA yi_k{;1\a!|[_¨ $0)0Eܯ`?:F4b.Pzlm39bo .VlSDYTJ%4'>$J:{| 45^X/~Imp3Y븆sBM`t"o?!J.|M LaAXS>F1EUFNpإH D4EOT#uVpX]sg.d $?oj>nS=zz ڪLW[00A괁jQ yAk!?R#Eu|k7  N1wtJ=ٷZ>:+lcRWyR` U@}k 1$vٴx@[S?ަ$DK[@qYql<>̷0\Pg%I˶u?]yLs}j[ދ(nw%6\hnv3#װ<O'aSE{?24VQov ~i׊7tgΖ!J4fd&gM^*W(ԝƇϿ`[K$g΁C ^M*ebW Ǝ5jO1k^M !*\JJM3fJKn H#%({1w<]=i_L;3)S D4󃳹|!xb$zDڅZ})9Pv-jde.,J`!('y. Vw} "!xx(~{>0Ib( ݃ͦj)5^8@{ԛ23c6M[ATz=$\l C*kEakףħ3[yI%&bFvYHލ;=U~$ wNܨs[J+˫wZAUO)V ai%Γx)qUo:ɊrE= S;De.9> }GXLb@C(=}vʻƧd$M2A='"b+Zyd-̎<ȇ!EkV+J-Һqz2- >>MꦽtkW+0ä"==ƈTJuO<4=9E>-|6XUr!& BD{aT΀,a(/'{M8"DBjl T'gjĠ:z6bűV~"]X\`D| !лx,==6t[\<#P%]Fd)pP9Cv#n{)%>jEeX`=HyQňy/갨ToJ•BTtq}]Xgn * uM| uD.*n2c]vؓD_El?|R/T'^=BphP$\0uQNKDO {0(:nU52s4hh?ýўG. 8#"<<"t.hܳk0O _E~|Wmt6<&je-zkҸŽ1McM }*1a,]wJ֍M/:GƷ!\sFl%gmebJp@;_0PT E7agߜü],uLB"n`k0{S&?^yeƫgԟ."2o Ebe Na%j~` h"^U^VuϗY| 0uIr(ƂdSjHP0&QmݤPZ/ߤ "N F8zz.k M9ȪJ/1`<m=ch .ÿ )B3hB:l?\DvBM vމNegB+>$S XeqF0T{O%q(3eai-_elQXw.7զQ_X3JYVhDPK~Ƭ(9y<8;g~ vN3|W}&jpxW >8o۾K_lpRiMܚtv73ň))vK9$iq4μM5*vZ: +۵6>dl=saރ)J7@{[ۥ3N u(Ԍ&pI.]EI~C}OqZ-wԞ\;EG bL:+b uA`b]AWj^^STR.WV]Ofdagpxe bJla uzקg_&1#*,}_}`繬M.Ȫ2xɉ?hiV"Ud{rbvJ8|h̒e FQVFf`9fnCҸ}k "H%(dEN'>k~!%tB=󃫔JI u eie<9IЫah~]>:߹N8*|,9 zܐۉ|“g0% cJ}YN n6z 8U$ u䮍ߥd3W8=oSwJXК!@;جL4V&]9u8ksJWZڸ`E>fJNG0:^O⥳hHûhXnjN@ƴ2`9s@Rx\°xJgnA[Ƹz $CJkPYGx9'Y>M%hVQ4?ٙh݅RpaW\+l/(ݬyvJ] QRoɤHNb='(`PEGX2ddsC5vY=VAOԳt.j  mB=sĖXEx@85D)jSDĥ.ufnf&`U%*5 #$j<{twj))y‰YfxE)aY5xi q1 S3&{eeg `6fR>SVir&0A ni,a8 *Xq)5bQ4W_eܦ= $VH&~;@)Jmk\kǽ)42J<43/ΤyGRd4r5^]kX%t/EbWl50v^s #9}`v彟P6o&CF3z/vV6l&۸à~(Ne3ݮ(ųq <M\h3Vxv Úφavçp< ?{!a6C:{IGj鉅UL/ݛPi]?8l#̝ReS܁Zxs F,1pBD]e-_@lN}8}?TqNf;ǎz&RVL%N<ް _LGRK`l4g 4{oovdZiYF.S?@wsn/k!Snf\RGg΃9LM`W/~55{! TQwj4`M 6LhWy2R vE |'5$um5ojo>RNFLi&>qM8|딻e3ГV7Y3Kь!AZV \]yH^5M_$}jΉFt܃@<,/n<:evyoۧNk逸q|ʖ:Xtry$'Tv| kfJgŴVnȠxB;yVųmzMu ~J^kYDWЗ?몟/R2IIe軉 Q:mZ͋,;Qxu Afܷ汔E?$&ixuQkRLDߚ*ʊ̡=[~-4އ݊XB8ztZ5)ÃFTc3Kʓ*͋˛""ր۵R/'+GF&B'=ZwMH f{Vl ˝+zzܨ4E`>ZkKrLUedJf|<v*vEx>[B}7Ƚ\Iڷ2T!INRy 3 Ƈb^rcaѣ6!tFv21*4Ep )o]Kȝ-] ]b&hv|tqJ0 ,'C*o)0,3{`\h!r7MX.f_.X44}>0&C'*Zq{Oq퇩&l>ɜJ8s"B1@UYx`5/x:}]"UK{}C`oπbznUS7 C*,o͑>4 "=%ncJ=I,(Vp66%\gC|Yڞ4 aUg"g.CLUPVBV+fgeodaC)S&)и ?lI0&ܒ3_Y|}DD: %bD08 -W*'A na4!R^ӟ?lѳ_=mqx-?y{l,B:9_D4굮ggP=4ӱ>~͟&UrUޞ&a90]knuaR;'4y"XHpwB(TO fthhFbi;C6K BNw%W2 \sΒQ?LscNCPFwQ+@s4 e_XݎUznZ}2m E[AjUP۫<}ퟺR TH a=؋5%wXYuA~ֳm,%,uoaЪ{q;[kU*YOg;zUܧ9WFNKR2L\.*0 Ǣ~ELcef?MQ~h_}yլpAtH<9e ;JEZ˗D&JAt YriQAzDE<6o# i̕ #Z(JZq$Xʀb)s?,{)S/m݋sҟc7gk<(.><kgh<Bzu B{~ZHIx+ ;eKi#TGC3qٞ1l1́lN H/~MG}|KI;h31X$GNYXt+B?.RE8_Bh#؉֎S yY^Bm[tCրR0_]s-(g35T,;TOWB]rw8bG/ݨM}M?\CA11[lZ%*Acxw9 kڟ IhK@kgzFoM"NSi+%64#w߸еIE"fQy8Bw$]c7Ǘ|ф+@)Ti>Bvٍ_D-5 .s!Fm!~_O¯8>NzzwiS>Jd)rc@vdO}$Ch"l0fԬd;Sс͓8$,Qd:YdGp1 PR*oW.4q#=9fiodYtuBNP  *+ vm'vT *6U6 ǫ `=8 O>16(k4kFͤDUq~U)Ocqwafzj vW; 'S5<˗aZ^b]T-1\Ho7<؈\@ Uuثe-BV/LCRx򩆣MǮk[|@ؙVyP+bmМv]&4?s_F3l?Vy}sջ1KV(+r|'R7&ZR[Exa$ӰEBTᡎ`#j.W' i^ M) EXM>'CLc@o\rYjA?Gey3 mc\?@C88Tt<%vLyA/BbаgR-UK 3n3qI!vY `3 K.K*iAUkek]߈yh{dodKq(0m_94+tSo81ԤgWp6DJ󄃿[P\/o;"#o_H>\FZyABtF77597hMT1+R™v%(an٩s4a4qX\Nn”*L61Y~WCzz_Q FmJYq~~P0X#抐ﭐc ?NpL-RIHѝ?rf ?^MAXLnꊛ0 uϬNvFt=ZGlv[fi&Bgje>OI- fj:X&&)x|Ovxb?}ew -F)P ; ^:zD f)t< "Mfo+ƲsF]D9Wf V XOI׉QE~"x*tm).j&0eG2b$ߔV{"Z|LTle, 1GQK:ũ%z @$n|]o(h岎f[p-P=%튝ytXͲ4<2Rޓs46~C]\t)x^8Hnlxw?x$f$!WDhh|ˣ֥|SC/s$.)F52ڜ7%E@pT# :۴CDWj?s%3<\_tLB#b)KLL߁;VawDNlJ+z=6 C/~{+G(Qx~| 8ϖJaۍ| `¦_zOꪆcbr;Bnr+JexU̜ 1_WޒI; 1.[mcRh^EjX+tm0.w\.Wa{ i߆~l^9iCS @?^u>ci 2UpY.M, B(cB[7뛀V"r1iZ"Ғa9owxݕt&ߕICm?S}̺p5 ei۶El1?yX+nk9#ZFW?Ͳ5ȢfqmeUMOF~l<#sK)e^ξpdt(R:gý__r `=0g) 'JsFZ(LsٮΡRG/0p9vtl$P8J[02(x]Anyx,@F+:"#3R<eq!i۳Շu^nۥ=2VR#U}@lm+Bdb*t*M{ŦT㦱:D86씮a^U]03r4uܐq!WʨF QL\%%׀Y`O(0b5_du5@m۵OlimEtE[OpAa:} vrp"lW8\̰d1 ٔN35ưxva<=[. ;mp(Y$IK4vJMj5#xh[#5("9*oTHD '%iE{שHfB4 BTo4ev%?Z;|❧(wegGaR}ʜL#ԯlczaceh{nV7\ pLCSar}p;OW"ނ7:磙Gv&ʉ4 K7H|Rl) EH݀ @NOc6){9]znLGgD tql6N1|pE7Ƭ|d꘧[^eX AkQ)h[tˮ63xSqL$Q6H)dk\H$K7~M݀ Z.:+k-01j#]`]rmSR쩉Q<ˀ$e$D:3{I4KzjLWcS܍h gO9BWJ~,PVi]G,%jۢ@xw{a Z󬤒tR^:ܑxrVZY0+pfڣtBu "H+ۼ<%[ 1f=]Q!XbI2E3q7hdpiќXHsOq³'FptNuNsyAC¾3?Oڕ{&7daj;VdWӹ'il2ZiZ}<z9-3 Utk^9ORcE_"!TRI09ڃ?Vwj_=< ĿG} s-&J1NVI64~\6L:q5rH*6MApgtJcJ ?Xh/~O_ۖK1)2=.GbdK'<܍f M1ih,nJⲒ+k{'\(.7 e$TT% XnE I:̈́!_RSYq;6FmZ'|aȘP Ԟǘ!rhORjW *Z_~VUX'l<,iJE(si[OkQLgàAby[k%3O2jџw`1PqhEB \luk"^Sܢ^1N%2[4gyNlIS!_< 3pYQ9n9a = %1p`ք֎[Ol)Y̡ob]P٤ٌ#<_4sP]l2;nnH.`Acf_5"|a6e &)ɇ(z<|l7:Sǒ(')xO)!~WsJa10< 'ZDP|bSWEGE g::N)i< ({ ,wShOFp ={:<10@^ k'e2hvZɦ)8bK$9ewJ]ԉ1kf!WNJӃOɨl1~bwZq!+. |GTs7wn|+hEKCnK%I`_dONyA!p~1C8"Z>!Y ?&)S9"򐮯9 Q 5'3EP(> Jh$2+$\&ԂxvȦ }3$|O3uxöIO_VATz7)yKOa"Mr4!W)l焖;eʊ 1n?VYbU`ǡλT"/tȣqQ{"s;??1[1Q,\¼jJ]hU$W[\X,)  =,1>'fUWX7HښK:qƗ^u_Kz&]_8qG &} 4ŤJӳe7ovbPtf<^)N%zQ0taWY}hqF@^AHBKf 0l +&Ke^ZvS JM0,_Aa,of}#N(2~x~4pP^ȣuW8/_1T6EȨ:<L=G/EZ0\?EV~Pj * (5 7%sw[#s%ujѧK"#bm+t4fOBZK*֋^+ /RLJinNN9r߼Gi;D ֯똷x4&(N&Ȱ`dǙ]V TP^,|O1}Z&rILEXE芣LcW 9T|n$ hɲV}d/e?Nfc9H@=>4;WO? =QDJejĿyz)`\n߻׍L2*pϩ&*&eB!O&a}+{:Jv|GΠ ѽgEO YY[dbF,#dҹFfR.ڊj͢F]Zёsŏ,I55Nϰ>.Ҩ@OB$Mk:iqICC.MB_.I&"" )ш+{XQZWQMB1pᘆ 5jSk\/lMiHs|ۈfGBO5ù Mw7|`U F)Q'01c!f2AYqA v .+[ԯG?ޛ'Q[F3,JmPsg_#UZ2K 3,Q8cuaQd+LzMNНN`=I^b@?6%LZ? z({ TA*ϗQyR:M^yvvƳ[7eө@sAb a|ueXa KVIj9Q%ч͌lc%C?) VPƯg=RMbT즻O8[<>P)[z S8MqAeCή27CƣB0Hj>I!b-1֖݆ިH E݃vhҏ]vrʧ#n𒑕Xb©i< ǭlg~"bXn(`f0NxI)ݎ5Q B%i\ΦsL_h) ~-fۑ!x|QcsxC6qLU'X.fu/!ؗGx50piG![.Ic(+occ6yJ2 U<˻%4z PX%& (1L;Zܩ*.! R\onr`a%9I0+42(Ό^73ˏKԭU 4ĒQr =&7rr%|Ir[&Y8zbg}{V 8N|zTCkW:?3fQUCd\BP NyHjj''d`g(%fU<ę`d{@#R,5h5cW1X^6'T}U҉ѱ4!lPpKuܑzßuіѥ,MOt#pT2r^ C4*ZQS7uh11$a!J QE@pZo;}^=t@ xMIRL7` k&{?)46DDE"!E&8QIm-l gudp F96D>rvXL9ukv7‰ac,I\5` 9aj}0M0E@35~5%a͑l@Ӟ[52wd9H Mg$uD OC7st HuLf `bqE4M^~ˑ`ph@Mwrth&ǀD2glv1d!zĉTl(_?a?i-c\{MKp3>pRm ʥrr>'g#"[`-D"v5~v 8ڛ&YҎP2.E7O%Wˣ q\uhK|p6.Ik1-P9;|UhDn}Qzy'q!>ۮ`-eA{T(~jh):s$w*\ 2҆' 2&^֦<Ϊ| &`cW/Gj 7l[Ϥ2Nk_/Fҥ GN쩲).jђ-.MlsE&1f󁿞;J%'h ;:I $@SC 7qC0tL됭"- jÃ׈k4)>ձ%b-o|ߞ\XeBAA/Ya.nt'b]֜4:&E+YXbv Jd掕|O<-4y89/)ty zބtc~i$Jp\3>&ֆZՙe16̀ d'gz鐶Kd\-)5 Xo«H| gfk}E %D]Z^Y+P?2I/=L$ܴK h<ÈeE7`Hv>e3"2X[ͺ!fd#t$q4WT#d''ULaEvO3$A}FRrU-L:C0D~qvr߫lOL}{\5cQmbe8Q墦Wk]F(3YxsS\>X-3.؆HKve!֟),HA-bG-dsF]t˖}β,2Dޠ$gG|=hÕ65Ÿ4?xZ# A=ԫv#l,4$0qm(8 )|aȔ cϯE J+X2p+1 5~?v7_ƶ#ʹ? 'F(+Ch OeOPIĄ*n-VbSA~c5JKR͢=FޣOK/7fͩu.L0A,$h~Ѹek"ܯK>Ll*-u