ktexteditor-devel-5.90.0-bp154.1.38 >  A b|œ!M@eeelZ,z Xv0/h+:PJgݨTHlA3RGܾ}5j!B37$Ԗ':iQm5my&ٗr0Yb? yށmT@ Q'7An3ƦҖ)[-W{Hr'80[*cc29a1f2d1e6b3d36caed8143334867d4ddaf0c93f19d28161eb5f35685a3040e428ec55c56aa15050a4b009634c3902daa860c3\b|œ!M@eee!qK æ.U^Jln^c<]C9(ہ!u+ҜGjlaaBʱ-;.DR2_iG8}~p>|?ld & h $04QZl MM M (M \M )M MMAMM`0(^8hg9 g:+gF>GTMHMIMX Y\DM] xM^ bcddefluMv wMxMyz  &hCktexteditor-devel5.90.0bp154.1.38Header files for ktexteditor, an embeddable text editor componentKTextEditor provides a text editor component that can be embedded in applications, either as a KPart or using the KF5::TextEditor library. This subpackage provides the header files.b|s390zp21Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Antonio Larrosa Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer lbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgalarrosa@suse.comlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgLuca Beltrame lbeltrame@kde.orgJan Engelhardt lbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.delbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orghrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.com- Update to 5.90.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.90.0 - Changes since 5.89.0: * Add a formatting commit to ignore-list * try to fix behavior for vimode on completion (kde#444883) * Change build system to make building against qt6 * Apply word filter on async completion models (kde#444883) * Validates the input method attributes received from input method. (kde#443977) * fix compile on Mac if EditorConfig is found * Remove unused exporting of SwapFile class symbols * Fix cursor position after completion tail restore * let cmake generate the PCH header completely * Introduce PCH support * Color current indentation line differently * Fix unused capture warning * Vimode-keyparser: Make some functions more efficient * Use KTextEditor::Range by value - Rebase 0001-Disable-KAuth-integration.patch- Update to 5.89.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.89.0 - Changes since 5.88.0: * Bring back git via QProcess * When reloading, don't override auto-detected hl mode if not set by user * If user didn't set them, don't override file type and highlighting modes detection * Pass KTextEditor::Cursor by value everywhere * Use const QString * Revert "completion: invoke always" * Remove selected text if preedit is not empty. * Disable "tail-available-on-undo" in ViInputMode * Fix vi-mode completion unit-tests * Improve built-in search performance * Remove duplicated lua.js indent file * Fix a compiler warning * Review KateTextLine usages * Create a separate path for fetching lineLength * Use iterators for iterating over blocks * Completion in two edits feature describing comment * Re-add "undo removed tail" on completion- Strip 'Source' URL for faster submissions- Update to 5.88.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.88.0 - Too many changes since 5.87.0, only listing bugfixes: * Expand katepart metadata (kde#444714) * TextFolding::importFoldingRanges: get rid of UB (kde#444726)- Update to 5.87.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.87.0 - Changes since 5.86.0: * Add Gitlab CI configuration * The user is not selecting as soon as we clearSelection * fix missing i18n (kde#442071)- Drop the unneeded baselibs.conf.- Update to 5.86.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.86.0 - Too many changes since 5.85.0, only listing bugfixes: * Python indentation: decrease indent when appropriate keyword is typed (kde#392732) * Do not show encoding error when file only contains BOM (kde#440359)- Update to 5.85.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.85.0 - Changes since 5.84.0: * Remove module prefix of include * Network mounts performance optimizations * KateView: speed up large view jumps * Fix apidox for class Mark * better comments * ensure close button on top for replace * move close button to right for bottom widgets- Update to 5.84.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.84.0 - Too many changes since 5.83.0, only listing bugfixes: * WIP: Take into account wordCompletionRemoveTail in completionRange() default implementation (kde#436170)- Update to 5.83.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.83.0 - Too many changes since 5.82.0, only listing bugfixes: * Limit shortcut context to active view for Reuse Word Above/Below (kde#352902) * Add "Transpose Words" feature (kde#436621) * Fix on-the-fly spell checking with recent Qt (kde#436004) * Revert "Add option to keep spaces to the left of cursor when saving" (kde#433455)- Update to 5.82.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.82.0 - Too many changes since 5.81.0, only listing bugfixes: * Fix dragging when folding stuff is around (kde#435500) * Fix incremental selection-only search (kde#327408) * Attempt fix crash on dragging (kde#435500) * fix memory corruption on 'Close the file, discard..' (kde#433180)- Update to 5.81.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.81.0 - Too many changes since 5.80.0, only listing bugfixes: * Don't warn about unsaved changes when closing if blank and unsaved (kde#391208) * Use QPalette::highlight for the scrollbar minimap slider (kde#434690) * Restrict horizontal range of cursor to avoid unintentionally wrapping. (kde#423253) * Add option to keep spaces to the left of cursor when saving (kde#433455) * fix unit tests => don't remove trailing spaces (kde#434163) * fix spellcheck word detection for non-ASCII (kde#433673) * fix auto-completion for non ASCII words (kde#433672)- Update to 5.80.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.80.0 - Too many changes since 5.79.0, only listing bugfixes: * use correct function to determine with of line number characters (kde#430712) * Add option to preselect nothing when automatic completion is invoked (kde#316413) * Temporarily save unfinished search/replace text (kde#411923) * avoid crash on clearing of bookmarks (kde#433006) * [Vimode] Do not remove empty lines when reformatting (kde#340550)- Update to 5.79.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.79.0 - Too many changes since 5.78.0, only listing bugfixes: * [Vimode] Do not switch view when changing case (~ command) (kde#432056) * Increase maximum indentation width to 200 (kde#432283) * Only show bookmark chars error when in vimode (kde#424172) * Retain replacement text as long as the power search bar is not closed (kde#338111) * Allow "Dynamic Word Wrap Align Indent" to be disabled (kde#430987) * [Vimode]Fix search inside fold ranges (kde#376934) * [Vimode] Fix Macro Completion Replay (kde#334032)- Update to 5.78.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.78.0 - Too many changes since 5.77.0, only listing bugfixes: * Show the dragged text when dragging (kde#398719) * Undo indent in one step (kde#373009)- Update to 5.77.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.77.0 - Changes since 5.76.0: * Port KComboBox to QComboBox * use KSyntaxHighlighting themeForPalette * fix i18n call, missing argument (kde#429096) * minor improvements to theme search * Improve the automatic theme selection- Update to 5.76.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.76.0 - Too many changes to list here.- Update to 5.75.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.75.0 - Too many changes to list here.- Update to 5.74.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.74.0 - Too many changes to list here.- Update to 5.73.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.73.0 - Changes since 5.72.0: * Use KF-standardized Qt logging categories * add icons to all buttons of file modified message (kde#423061) * Revert changes in autotests. It seems that camelcase changes breaks them * Use camelcase include. (scripted) * Use the canonical docs.kde.org URLs- Update to 5.72.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.72.0 - Changes since 5.71.0: * Make "goto line" work backwards (kde#411165) * fix crash on view deletion if ranges are still alive (kde#422546)- Update to 5.71.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.71.0 - Changes since 5.70.0: * Add .diff to the file-changed-diff to enable mime detection on windows. * scrollbar minimap: performance: delay update for inactive documents * Make text always align with font base line * Port from KRun::runUrl to OpenUrlJob * Fix modified line marker in kate minimap * Port to KIO::statDetails. We only need StatBasic since we only need the permissions- Update to 5.70.1 * Revert "Store and fetch complete view config in and from session config" (kde#421375)- Update to 5.70.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.70.0 - Changes since 5.69.0: * fix drag'n'drop on left side border widget (kde#420048) * Revert premature port to unreleased Qt 5.15 * Store and fetch complete view config in and from session config- Update to 5.69.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.69.0 - Changes since 5.68.0: * Make it compile against q5.15 (QString:: is deprecated) * Add missing include * fix folding crash for folding of single line folds (kde#417890) * fix unit test * [VIM Mode] Add g g commands (kde#418486) * Add MarkInterfaceV2, to s/QPixmap/QIcon/g for symbols of marks * Draw inlineNotes after drawing word wrap marker- Update to 5.68.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.68.0.php - Changes since 5.67.0: * templates: Convert license statements to SPDX headers * Remove duplicate include * README.md: fix example code & code markup * Fix minor EBN issues (http->https) * Make it compile against last qt5.15 without deprecated method. QOverload::of(&QComboBox::currentIndexChanged) is deprecated * Add an option to dynamic-break inside words * Use ecm_qt_install_logging_categories over manual categories file * KateModeMenuList: don't overlap the scroll bar- Replace %make_jobs with %cmake_build.- Update to 5.67.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.67.0.php - Too many changes since 5.66.0, only listing bugfixes: * fix Drag© function (by using Ctrl Key) (kde#413848)- Update to 5.66.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.66.0.php - Changes since 5.65.0: * Fix warning about unused variable and minor optimization * Add "line-count" property to the ConfigInterface * Avoid unwanted horizontal scrolling (kde#415096) * Port deprecated QSet::toList() method * Update the obsolete projects.kde.org URL- Update to 5.65.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.65.0.php - Changes since 5.64.0: * KateModeManager::updateFileType(): validate modes and reload menu of the status bar * Remove unused include * Remove KIconThemes use * Verify modes of the session config file * LGPLv2+ after ok by Svyatoslav Kuzmich * restore files pre-format * don't touch templates/- Update to 5.64.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.64.0.php - Too many changes since 5.63.0, only listing bugfixes: * fix crash (kde#413474) * add missing s (kde#413158) - Drop 0001-fix-crash-in-variableexpansionhelpers.patch. Merged upstream.- Add 0001-fix-crash-in-variableexpansionhelpers.patch to fix a crash when adding a variable to swap file name (kde#413474)- Update to 5.63.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.63.0.php - Too many changes since 5.62.0, only listing bugfixes: * QRectF instead of QRect solves clipping issues, even thought the rectangle has pure integer coordinates/sizes (kde#390451) * Add keyboard shortcut for switching Input modes to edit menu (kde#400486) * Backup on save: Support time and date string replacements (kde#403583)- Update to 5.62.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.62.0.php - Changes since 5.61.0: * Allow to customize attributes for KSyntaxHighligting themes * More port away from Qt's foreach all loops over method-local containers * Port away from Qt's foreach all loops over rvalue container objects * Port away from Qt's foreach all loops over method-local containers * Fix for all themes: allow turn off attributes in XML highlighting files * play in unit test with better searchText implementation * fix build when using Qt 5.11 * simplify isAcceptableInput + allow all stuff for input methods * simplify typeChars, no need for return code without filtering * Mimic QInputControl::isAcceptableInput() when filtering typed characters (kde#396764) * try to sanitize line endings on paste (kde#410951) * Fix: allow turn off attributes in XML highlighting files * improve word completion to use highlighting to detect word boundaries (kde#360340) * More porting from QRegExp to QRegularExpression * properly check if diff command can be started for swap file diffing (kde#389639) * KTextEditor: Fix left border flicker when switching between documents * Migrate some more QRegExps to QRegularExpression * Add .clangd to .gitignore list * fix vi mode unit test * Allow 0 in line ranges in vim mode. * Use CMake find_dependency instead of find_package in CMake config file template. - Replace foo-devel with cmake(KF5Foo) in build requirements- Update to 5.61.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.61.0.php - Changes since 5.60.0: * Save and load page margins * Don't persist authentication * Re-map default "Switch input mode" shortcut to not confict with konsolepart (kde#409978) * Make keyword completion model return HideListIfAutomaticInvocation by default * Minimap: Do not grab the left-mmouse-button-click on up/down buttons * Fix minor typos * allow up to 1024 hl ranges instead of not higlighting the line at all if that limit is reached * fix folding of lines with end position at column 0 of a line (kde#405197) * move enum to dialog, only used there * Add option to treat some chars also as "auto bracket" only when we have a selection * Add an action to insert a non-indented newline (kde#314395) * Add setting to enable/disable text drag-and-drop (on by default)- Don't lower minimum Qt version anymore, it requires 5.11 now - Drop conditionals for no longer supported distribution versions- Update to 5.60.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.60.0.php - Changes since 5.59.0: * fix goto line centering force center for any external set cursor position call (kde#408418) * Fix bookmark icon display on icon border with low dpi * Fix action "Show Icon Border" to toggle border again * Remove ifdef for Qt 5.11 since we require that version now * Fix compiler warning about unused variable * Fix empty pages in print preview and lines printed twice (kde#348598) * remove no longer used header * fix unit test for all operating systems * fix unit test * fix autoscrolling down speed (kde#408874) * Add default variables for variables interface * Make automatic spellcheck work after reloading a document (kde#408291) * raise default line length limit to 10000 * WIP:Disable highlighting after 512 characters on a line. * KateModeMenuList: move to QListView * Install in new logging directory when we use kf5 5.59.0- Update to 5.59.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.59.0.php - Changes since 5.58.0: * Don't delete entire previous line by backspace in pos 0 (kde#408016) * Use native dialog overwrite check * Review del/backspace * Add action to reset font size * show static word wrap marker always if requested * Ensure highlighted range begin/end marker after unfold * Fix: don't reset Highlight when saving some files (kde#407763) * Auto indentation: Use std::vector instead of QList * Fix: Use default indentation mode for new files * remove duplicated assignment * honor auto-bracket setting for balance check * improve invalid character check on loading (kde#406571) * New menu of syntax highlighting in the status bar * Avoid infinite loop in "Toggle Contained Nodes" action- Update to 5.58.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.58.0.php - Changes since 5.57.0: * Too many changes to list here- Update to 5.57.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.57.0.php - Changes since 5.56.0: * Too many changes to list here- Update to 5.56.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.56.0.php - Changes since 5.55.0: * Remove override keyword * Use isEmpty here * Remove deprecated method * try to improve painting height for text lines - bug 403868 avoid to cut _ and other parts still broken: double height things like mixed english/arab, see bug 404713 (kde#403868) * Use QTextFormat::TextUnderlineStyle instead of QTextFormat::FontUnderline (kde#399278) * Make it possible to show all spaces in the document (kde#381267, kde#342811) * Do not print indent lines * KateSearchBar: Show also search has wrapped hint in nextMatchForSelection() aka Ctrl-H * katetextbuffer: refactor TextBuffer::save() to better separate code paths * Use AuthCore instead of Auth * Remove dead code * Explicitly link against KAuth * Refactor KateViewInternal::mouseDoubleClickEvent(QMouseEvent *e) * Improvements to completion * Add TODO KF6 note * Set the color scheme to Printing for Print Preview (kde#391678) - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Downgrade the Qt version requirement to build with 5.9- Update to 5.55.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.55.0.php - Changes since 5.54.0: * skip cppstyle indentation test for !t 5.12.0 which has a broken regex implementation in JS * KateSpellCheckDialog: Remove action "Spellcheck Selection" * Update JavaScript library underscore.js to version 1.9.1 * Fix bug 403422: Allow changing the marker size again (kde#403422) * Consistently use override, not Q_DECL_OVERRIDE * SearchBar: Add Cancel button to stop long running tasks * Remove explicit use of ECM_KDE_MODULE_DIR, is part of ECM_MODULE_PATH * Review KateGotoBar * ViewInternal: Fix 'Go to matching bracket' in override mode * Delete copy constructor and assignment operator from public vim/ classes * delete copy constructor and assignment operator of some internal classes * Use HTTPS, if available, in links visible to users * Review KateStatusBar * ViewConfig: Add option to paste at cursor position by mouse (kde#363492) * Use the nicer K_PLUGIN_CLASS_WITH_JSON * Remove Qt version check- Update to 5.54.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.54.0.php - Changes since 5.53.0: * Fix unit test that arbitrarily fails * fix scripting for Qt 5.12 * Fix emmet script by using HEX instead of OCT numbers in strings (kde#386151) * Fix broken Emmet (kde#386151) * ViewConfig: Add 'Dynamic Wrap At Static Marker' option * fix folding region end, add ending token to the range * avoid ugly overpainting with alpha * Don't re-mark words added/ignored to the dictionary as misspelled (kde#387729) * KTextEditor: Add action for static word wrap (kde#141946) * ViewPrivate: Don't hide 'Clear Dictionary Ranges' action * KateStatusBar: Reformatted by astyle command to follow coding style * Don't ask for confimation when reloading (kde#401376) * class Message: Use inclass member initialization * KTextEditor::Message: Review documentation * use STL were no implicit sharing is required * Expose KTextEditor::ViewPrivate:setInputMode(InputMode) to KTextEditor::View * improve range handling, no allocations for common updates (kde#333517) * KateViewInternal: Rename getMouse/Cursor() => mouse/cursorPosition() to fit coding style * tune editing actions for large number of small edits * Only cal updateView() in visibleRange() when endPos() is invalid. * KateViewInternal: S&R- Update to 5.53.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.53.0.php - Changes since 5.52.0: * KTextEditor::ViewPrivate: S&R * KateViewInternal: Remove unneeded functions * Allow negative syntax definition priorities. * Expose "Toggle Comment" feature through tools menu and default shortcut (kde#387654) * Fix hidden languages in the mode menu * SpellCheckBar: Use DictionaryComboBox instead of plain QComboBox * KTextEditor::ViewPrivate: Avoid warning "Text requested for invalid range" * Android: No need to define log2 anymore * disconnect contextmenu from all aboutToXXContextMenu receivers (kde#401069) * Introduce AbstractAnnotationItemDelegate for more control by consumer- Update to 5.52.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.52.0.php - Changes since 5.51.0: * Remove unused variables * Fix minor EBN issues and typos * Fix align of doxygen comments in templates * Use normalized signatures with SIGNAL(), SLOT(), Q_ARG(), Q_RETURN_ARG() * Remove duplicated includes * Use more explicit constructors with internal classes * Remove double underscore (__) from header include guards * Minor: Cleanup some code- Run spec-cleaner- Update to 5.51.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.51.0.php - Changes since 5.50.0: * Restaure default severity * Autogenerate debug file + create categories file * Port to no deprecated method * Paint code folding marker only for multiline code folding regions * Intialize m_lastPosition * Scripting: isCode() returns false for dsAlert text * fix ebn issues * use R Script hl for R indent tests * Unit tests for the R indent script * Update of the R indent script * Fix Solarized Light and Dark color schemes (kde#382075) * Don't require Qt5::XmlPatterns- Trim bias from description.- Update to 5.50.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.50.0.php - Changes since 5.49.0: * Too many changes to list here - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Update to 5.49.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.49.0.php - Changes since 5.48.0: * proper fix for the raw string indenting auto-quoting * fix indenter to cope with new syntax file in syntaxhighlighting framework * adjust test to new state in syntax-highlighting repository * Show "Search wrapped" message in center of view for better visibility * fix warning, just use isNull() * Extend Scripting API * fix segfault on rare cases where empty vector occurs for word count happens e.g. sometimes for vimode_emulatedcommandbar test * enforce clear of scrollbar preview on document clear BUG: 374630 (kde#374630)- Update to 5.48.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.48.0.php - Changes since 5.47.0: * use nullptr, not 0 * add missing const qualifiers * guard updateConfig for disabled status bars * add context menu to statusbar to toggle show total lines/word count * Implemented displaying of total lines in kate (kde#387362) * Make menu-bearing toolbar buttons show their menus with normal click rather than click-and-hold (kde#353747) * CVE-2018-10361: privilege escalation * Fix caret width (kde#391518)- Update to 5.47.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.47.0.php - Changes since 5.46.0: * Warning-- * Use override * Don't use title case for the "show word count" checkbox * Make the word/char count a global preference- Update to 5.46.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.46.0.php - Changes since 5.45.0: * optimization of KTextEditor::DocumentPrivate::views() * [ktexteditor] much faster positionFromCursor * Implement single click on line number to select line of text * Warning-- * Add missing override * Fix problem that font/italic/... attributes no longer work with e.g. >= Qt 5.9 * clang-tidy: modernize-use-default-member-init run - Dropped patches, now upstream: * Fix-font-attributes.patch- Add Fix-font-attributes.patch to fix missing bold/italic/... markup with modern Qt versions (>= 5.9)- Update to 5.45.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.45.0.php - Changes since 5.44.0: * Make it possible for KTextEditor to build on Android NDK's gcc 4.9 * avoid Asan runtime error: shift exponent -1 is negative * We depend against 5.8.0 * optimization of TextLineData::attribute * Don't calculate attribute() twice. * Revert Fix: View jumps when Scroll past end of document is enabled (kde#391838) * don't pollute the clipboard history with dupes * Revert "[KateCompletionWidget] Create configuration interface on demand" (kde#391955) * [KateCompletionWidget] Create configuration interface on demand * Remove not necessary QtCore and co- Update to 5.44.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.44.0.php - Changes since 5.43.0: * Initialize value * Iterate over initializer_lists to avoid mem allocs * Add icons for KTextEditor Document-Export, Bookmark-Remove and Formatting Text Upppercase, Lowercase and Capitalize- Update to 5.43.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.43.0.php - Changes since 5.42.0: * improve line heigh computation try to avoid cutting of parts of glyphs * Fix: View jumps when Scroll past end of document is enabled (kde#306745) * KateView unit test: simplify finding KateViewInternal * Use at least the requested width for the argument hint tree * ExpandingWidgetModel: find the right-most column based on location * Simplify code: return early to reduce indentation depth- Update to 5.42.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.42.0.php - Changes since 5.41.0: * Remove obsolete reviewboardrc file * clang-tidy modernize-use-override * Fix wildcard matching for modelines * Fix Unit Test * Fix compilation * Fix a regression caused by changing backspace key behavior * port to non-deprecated API like already used at other place (kde#386823) * Add missing include for std::array * MessageInterface: Add CenterInView as additional position * Verify if QTest::qWaitForWindowExposed returns true * QStringList initializer list cleanup * Migrate some QRegExps to QRegularExpression * Fix warning about unused variable * Fix syntax unit tests * Fix API documentation about RangeCommand- Update to 5.41.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.41.0.php - Changes since 5.40.0: * Use directly QStringLiteral * We depend against 5.7 * API dox: fix section id * Plugin template: remove bogus translation strings * Fix VI-Mode buffer commands * Remove unused member variable * prevent accidental zooming. * autotests: Remove dep on Qt5::Script again * Fix: Missing dependencies for ktexeditor autotests- Update to 5.40.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.40.0.php - Changes since 5.39.0: * API dox: fix wrong names of methods and args, add missing \since * Avoid (certain) crashes while executing QML scripts (kde#385413) * Avoid a QML crash triggered by C style indentation scripts * - Increase size of trailing mark * add autotests for D8333 * fix some indenters from indenting on random characters * Fix deprecation warning - Remove patches, now upstream: * fix-some-indenters-from-indenting-on-random-characters.patch- Add fix-some-indenters-from-indenting-on-random-characters.patch to fix broken indentation of some languages (e.g. Python)- Update to 5.39.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.39.0.php - Changes since 5.38.0: * Ignore default mark in icon border for single selectable mark * Minor spell check interface fixes * Use QActionGroup for input mode selection * Fix missing spell check bar (kde#359682) * Fix the fall-back "blackness" value for unicode > 255 characters. (kde#385336) * Plugin template: fix name of Messages.sh * Fix trailing space visualization for RTL lines. * fix typo approved by Dominik Haumann- Add 0001-Disable-KAuth-integration.patch * Streamlined way to disable KAuth support from ktexteditor - Remove patches, folded into the above: * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.38.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.38.0.php - Changes since 5.37.0: * Port Document/View scripting API to QJSValue-based solution * Show icons in icon border context menu * Use config.h more * Fix compilation on windows with editorconfig-c-core available * Replace KStandardAction::PasteText with KStandardAction::Paste * Support fractional scaling in generating the sidebar preview * Fix build with QT_NO_ACCESSIBILITY * Switch from QtScript to QtQml- Update to 5.37.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.37.0.php - Changes since 5.36.0 : * Handle fine-grained wheel event in zooming * Add template for a ktexteditor plugin * Add KF6 TODO for missing argument namespace in slot signature * copy permissions from original file on save copy BUG: 377373 (kde#377373) * perhaps avoid stringbuild crash BUG: 339627 (kde#339627) * fix problem with * adding for lines outside of comments BUG: 360456 (kde#360456) * fix save as copy, it missed to allow overwriting the destination file we check if we want that via a dialog, but we still always fail to do so BUG: 368145 (kde#368145) * Adapt unit test to changes from KSyntaxHighlighting framework * Command 'set-highlight': Join args with space * fix crash on view destruction because of non-deterministic cleanup of objects * Emit signals from icon border when no mark was clicked * Fix crash in vi input mode (sequence: "o" "Esc" "O" "Esc" ".") (kde#377852) * Use mutually exclusive group in Default Mark Type- Update to 5.36.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.36.0.php - Changes since 5.35.0: * Fix cpu usage spiking after showing vi command bar (kde#376504) * Fix jumpy scrollbar-dragging when mini-map is enabled. * Jump to the clicked scrollbar position when minim-map is enabled. (kde#368589) * [FEATURE] Option to build & install QCH file with the public API dox- Update to 5.35.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.35.0.php - Changes since 5.34.0: * Add Q_FALLTHROUGH * Add missing break * Unbreak KateSyntaxTest in paths with dots, check only dir entry name for . * Revert "Add temporary debug output for investigating KateSyntaxTest fail on CI" * Add temporary debug output for investigating KateSyntaxTest fail on CI * Remove duplicated path separator * Unbreak autotests in paths with spaces, properly escape " chars * Use explicit flag values or explicit constructor instead of nullptr- Update to 5.34.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.34.0.php - Changes since 5.33.0: * KAuth integration in document saving - vol. 2 - various security improvements * Fix assertion when applying code folding that changes cursor position * Use non-deprecated root element in ui.rc file * Add scroll-bar-marks also to the built-in search&replace * KAuth integration in document saving - Revert upstream feature as disliked by the security team (boo#1033055) * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.33.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.33.0.php - Changes since 5.32.0: * Upgrade ECM and KF5 version requirements for 5.33.0 release. * fix debug warning (and wrong pen value) found by kfunk, introduced my me * Expose additional internal View's functionality to the public API * Upgrade KF5 version to 5.33.0. * save a lot of allocation for setPen * Fix ConfigInterface of KTextEditor::Document * Add unit test for KTextEditor::ConfigInterface * Added font and on-the-fly-spellcheck options in ConfigInterface- Enable editorconfig support only on TW and Leap >= 42.2- Enable editorconfig support- Update to 5.32.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.32.0.php - Changes since 5.31.0: * Commit translations from l10n-kf5 * Fix compilation with Qt 5.6 * Upgrade ECM and KF5 version requirements for 5.32.0 release. * Remember file type set by user over sessions * Reset filetype when opening url * Added getter for word-count configuration value * vimode_completion unit test failure * Consistent conversion from/to cursor to/from coordinates * Update file type on save only if path changes * EditorConfig support * add FindEditorConfig to ktexteditor if that proves to be useful, can be moved to extra-cmake-modules, thought I see its use is rather specialized to ktexteditor * Fix: emmetToggleComment action doesn't work * Use sentence style capitalization with label texts of edit fields * Reverse meaning of :split, :vsplit to match vi and Kate actions. * Use C++11 log2() instead of log() / log(2) * KateSaveConfigTab: put spacer behind last group on Advanced tab, not inside * KateSaveConfigTab: Remove wrong margin around content of Advanced tab * Borders config subpage: fix scrollbar visibility combobox being off-placed * Upgrade KF5 version to 5.32.0.- Update to 5.31.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.31.0.php- Update to 5.30.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.30.0.php- Update to 5.29.0 * Prevent Qt warnings about an unsupported clipboard mode on Mac * Use syntax definitions from KF5::SyntaxHighlighting * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.29.0.php- Update to 5.28.0 * Breeze Dark: Darken current-line background color for better readability (kde#371042) * Sorted Dockerfile instructions * Breeze (Dark): Make comments a bit lighter for better readability (kde#371042) * Fix CStyle and C++/boost indenters when automatic brackets enabled (kde#370715) * Add modeline 'auto-brackets' * Fix inserting text after end of file (rare case) * Fix invalid xml highlighting files * Maxima: Remove hard-coded colors, fix itemData Label * Add OBJ, PLY and STL syntax definitions * Add syntax highlighting support for Praat * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.28.0.php- Update to 5.27.0 * XML files: remove hard-coded color for values * XML: Remove hard-coded color for values * XML Schema Definition: Turn 'version' into an xs:integer * Highlighting definition files: round version up to next integer * Support multi char captures only in {xxx} to avoid regressions * Support regular expressions replaces with captures > \9, e.g. I (kde#365124) * Fix rendering of characters spanning into next line, e.g. underlines are no longer cut off with some fonts/font-sizes (kde#335079) * Fix crash: Make sure the display cursor is valid after text folding (kde#367466) * KateNormalInputMode needs to rerun SearchBar enter methods * try to "fixup" rendering of underlines and stuff like that (kde#335079) * Show "View Difference" button only, if 'diff' is installed * Use non-modal message widget for externally modified file notifications (kde#353712) * Fix regression: testNormal did only work because of test execution at once * Split the indent test into separate runs * Support "Unfold Toplevel Nodes" action again (kde#335590) * Fix crash when showing top or bottom messages multiple times * Fix eol setting in mode lines (kde#365705) * Highlight .nix files as bash, guess can't hurt (kde#365006) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.27.0.php- Update to 5.26.0 * Remove accel clash (kde#363738) * Fix email address highlighting in doxygen (kde#363186) * Detect some more json files, like our own projects ;) * Improve mime-type detection (kde#357902) * Bug 363280 - highlighting: c++: #if 1 #endif #if defined (A) aaa [#]elif defined (B) bbb #endif (kde#363280) * Bug 351496 - Python folding is not working during initial typing (kde#351496) * Bug 365171 - Python syntax highlighting: not working correctly for escape sequences (kde#365171) * Bug 344276 - php nowdoc not folded correctly (kde#344276) * Bug 359613 - Some CSS3 properties are not supported in syntax highlight (kde#359613) * Bug 367821 - wineHQ syntax: The section in a reg file isn't highlighted correctly (kde#367821) * Improve swap file handling if swap directory specified * Fix crash when reloading documents with auto-wrapped line due to line length limit (kde#366493) * Fix constant crashes related to the vi command bar (kde#367786) * Fix: Line numbers in printed documents now starts at 1 (kde#366579) * Backup Remote Files: Treat mounted files also as remote files * Cleanup logic for searchbar creation * Add highlighting for Magma * Allows only one level of recursion * Fix broken swap-file on windows * Patch: add bitbake support for syntax highlighting engine * Autobrace: look at spellcheck attribute where the character was entered (kde#367539) * Highlight QMAKE_CFLAGS * Don't pop out of the main context * Add some executable names that are commonly used * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.26.0.php- Update to 5.25.0 * Qt >= 5.5 is now required * Do not ask for overwriting a file twice with native dialogs * Added FASTQ syntax * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.25.0.php- Update to 5.24.0 * Show Scrollbar Text Preview after a delay of 250ms * Hide preview and stuff on view content scrolling * Set parent + toolview, I think this is needed to avoid task switcher entry in Win10 * Remove "KDE-Standard" from encoding box * Folding preview on per default * Avoid dashed underline for preview & avoid poisoning of line layout cache * Always enable "Show preview of folded text" option * TextPreview: Adjust the grooveRect-height when scrollPastEnd is enabled * Scrollbar preview: use groove rect if scrollbar does not use full height * Add KTE::MovingRange::numberOfLines() just like KTE::Range has * Code folding preview: set popup height so that all hidden lines fit * Add option to disable preview of folded text * Add modeline 'folding-preview' of type bool * View ConfigInterface: support 'folding-preview' of type bool * Add bool KateViewConfig::foldingPreview() and setFoldingPreview(bool) * Feature: Show text preview when hovering over folded code block * KateTextPreview: add setShowFoldedLines() and showFoldedLines() * Add modelines 'scrollbar-minimap' [bool], and 'scrollbar-preview' [bool] * Enable mini-map scrollbar by default * New feature: Show text preview when hovering over the scrollbar * KateUndoGroup::editEnd(): pass KTE::Range by const ref * Fix vim-mode shortcut handling, after behaviour changes in Qt 5.5 (kde#353332) * Autobrace: don't insert ' character in text * ConfigInterface: add scrollbar-minimap config key to enable/disable scrollbar mini map * Fix KTE::View::cursorToCoordinate() when top message widget is visible * Refactoring of the Emulated Command Bar * Fix drawing artifacts when scrolling while notifications are visible (kde#363220) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.24.0.php- Update to 5.23.0 * Fix default encoding to UTF-8 (kde#62604) * Fix color configurability of default style "Error" * Search & Replace: Fix replace background color (regression introduced in v5.22) (kde#63441) * New color scheme "Breeze Dark", see https://kate-editor.org/?post=3745 * KateUndoManager::setUndoRedoCursorOfLastGroup(): pass Cursor as const reference * sql-postgresql.xml improve syntax highlighting by ignoring multiline function bodies * Add syntax highlighting for Elixir and Kotlin * VHDL syntax highlighting in ktexteditor: add support for functions inside architecture statements * vimode: Don't crash when given a range for a nonexistent command (kde#60418) * Properly remove composed characters when using Indic locales * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.23.0.php- Update to 5.22.0 (boo#980066) * Use proper char syntax '"' instead of '\"' * doxygen.xml: Use default style dsAnnotation for "Custom Tags" as well (less hard-coded colors) * Add option to show the counter of words * Improved foreground color contrast for search & replace highlightings * Fix crash when closing Kate through dbus while the print dialog is open (kde##356813) * Cursor::isValid(): add note about isValidTextPosition() * Add API {Cursor, Range}::{toString, static fromString} * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.22.0.php- Update to 5.21.0 (boo#974793) * Revert "Open/Save config page: Use term "Folder" instead of "Directory"" * Open/Save config page: Use term "Folder" instead of "Directory" * kateschemaconfig.cpp: use correct filters with open/save dialogs (kde#343327) * c.xml: use default style for control flow keywords * isocpp.xml: use default style "dsControlFlow" for control flow keywords * c/isocpp: add more C standard types * KateRenderer::lineHeight() returns an int * printing: use font size from selected printing schema (kde#356110) * cmake.xml speedup: Use WordDetect instead of RegExpr * Change tab with to 4 instead of 8 * Fix changing the current line number color * Fix selecting completion item with the mouse (kde#307052) * Add syntax highlighting for gcode * Fix the MiniMap selection background painting * Fix encoding for gap.xml (use UTF-8) * Fix nested comment blocks (kde#358692) * Upgrade Qt version requirement to 5.4.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.21.0.php - Drop upstreamed 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Added 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Update to 5.20.0 (boo#970856) * Fix highlighting of all occurences in ReadOnlyPart * Don't iterate over a QString as if it was a QStringList * Properly initialize static QMaps * Prefer toDisplayString(QUrl::PreferLocalFile) * Support surrogate character sending from input method * Do not crash on shutdown when text animation is still running * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.20.0.php- Update to 5.19.0 (boo#967668) * Better behaviour for "insert braces around" autobrace feature * Change option key to enforce new default, Newline at End of File = true * Remove some suspicious setUpdatesEnabled calls (kde#353088) * Delay emitting of verticalScrollPositionChanged until all stuff is consistent for folding (kde#342512) * Patch updating tag substitution (kde#330634) * Only update the palette once for the change event belonging to qApp (kde#358526) * Append newlines at EOF by default * Add NSIS syntax highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.19.0.php- Update to 5.18.0 * Syntax h/l for pli: builtin functions added, expandable regions added * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.18.0.php- Update to 5.17.0 * Add syntax highlighting for TaskJuggler and PL/I * Make it possible to disable keyword-completion via the config interface. * Resize the tree when the completion model got reset. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.17.0.php- Update to 5.16.0 (boo#955067) * highlighting: gnuplot: add .plt extension * fix validation hint, add hint about the compile time validation * Don't crash when command is not available. * Fix kde##307107 * Haskell highlighting variables starting with _ * simplify git2 init, given we require recent enough version (kde#353947) * bundle default configs in resource * syntax highlighting (d-g): use default styles instead of hard-coded colors * better scripts search, first user local stuff, then the stuff in our resources, then all other stuff, that way the user can overwrite our shipped scripts with local ones * package all js stuff in resources, too, only 3 config files missing and ktexteditor could be just used as a library without any bundled files * next try: put all bundled xml syntax files into a resource * add input mode switch shortcut (kde#347769) * bundle xml files in resource * syntax highlighting (a-c): migrate to new default styles, remove hard-coded colors * syntax highlighting: remove hard-coded colors and use default styles instead * syntax highlighting: use new default styles (removes hard-coded colors) * Better "Import" default style * Introduce "Save As with Encoding" to save a file with different encoding, using the nice grouped encoding menu we have and replacing all save dialogs with the correct ones of the operating system without loosing this important feature. * bundle ui file into lib, using my extension to xmlgui * Printing again honors the selected font & color schema (kde#344976) * Use breeze colors for saved and modified lines * Improved icon border default colors of scheme "Normal" * autobrace: only insert brace when next letter is empty or not alphanumeric * autobrace: if removing start parenthesis with backspace, remove end as well * autobrace: only establish connection once * Autobrace: eat closing parentheses under some conditions * Fix shortcutoverride not being forwarded to the mainwindow * Bug 342659 - Default "bracket highlighting" color is hard to see (Normal schema fixed) (kde#342659) * Add proper default colors for "Current Line Number" color * bracket matching & auto-brackets: share code * bracket matching: guard against negative maxLines * bracket matching: just because the new range matches the old doesn't mean no update is required * Add the width of half a space to allow painting the cursor at EOL * fix some HiDPI issues in the icon border * fix kde##310712: remove trailing spaces also on line with cursor (kde#310712) * only display "mark set" message when vi input mode is active * remove & from button text (kde#345937) * fix update of current line number color (kde#340363) * implement brackets insert on writing a bracket over a selection (kde#350317) * auto brackets (kde#350317) * fix alert HL (kde#344442) * no column scrolling with dyn word wrap on * remember if highlighting was set by user over sessions to not loose it on save after restore (kde#332605) * fix folding for tex (kde#328348) * fixed kde##327842: End of C-style comment is misdetected (kde#327842) * save/restore dyn word wrap on session save/restore (kde#284250) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.16.0.php- Update to 5.15.0 * Validate more regexp * Fix regexps in HL files (kde#352662) * Sync ocaml HL with state of https://code.google.com/p/vincent-hugot-projects/ before google code is down, some small bugfixes * Add word-break (kde#352258) * Validate line before calling folding stuff (kde#339894) * Fix Kate word count issues by listening to DocumentPrivate instead of Document (kde#353258) * Update Kconfig syntax highlighting: add new operators from Linux 4.2 * Sync w/ KDE/4.14 kate branch * Minimap: Fix scrollbar handle not being drawn with scrollmarks off. (kde#352641) * Syntax: Add git-user option for kdesrc-buildrc * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.15.0.php- Update to 5.14.0 * Merge allocation of TextLineData and ref count block. * Change default keyboard shortcut for "go to previous editing line" * Syntax highlighting Haskell comment fixes * Speed up code-completion pop-up appearance * minimap: Attempt to improve the look and feel (kde#309553) * nested comments in Haskell syntax highlighting * Fix problem with wrong unindent for python (kde#351190) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.14.0.php- Update to 5.13.0 * The Qt version requirement has been bumped from 5.2 to 5.3 * Debug output has been ported to categorized output, for less noise by default * Docbook documentation has been reviewed and updated * Guard default log level for Qt < 5.4.0, fix log cat name * Add hl for Xonotic (kde#342265) * Add Groovy HL (kde#329320) * Update J highlighting (kde#346386) * Make compile with MSVC2015 * Less iconloader use, fix more pixelated icons * Enable/disable find all button on pattern changes * Improved search & replace bar * Remove useless ruler from powermode * More slim search bar * vi: Fix misreading of markType01 flag * Use correct qualification to call base method. * Remove checks, QMetaObject::invokeMethod guards itself against that already. * Fix HiDPI issues with color pickers * Cleanup coe: QMetaObject::invokeMethod is nullptr safe. * More comments * Change the way the interfaces are null safe * Only output warnings and above per default * Remove todos from the past * Use QVarLengthArray to save the temporary QVector iteration. * Move the hack to indent group labels to construction time. * Fixup some serious issues with the KateCompletionModel in tree mode. * Fix broken model design, which relied on Qt 4 behavior. * Obey umask rules when saving new file (kde#343158) * Add meson HL * As Varnish 4.x introduces various syntax changes compared to Varnish 3.x, I wrote additional, separate syntax highlighting files for Varnish 4 (varnish4.xml, varnishtest4.xml). * Fix HiDPI issues * vimode: don't crash if the command gets executed in the end of a document. (kde#350299) * Support QML multi-line strings. * Fix syntax of oors.xml * Add CartoCSS hl by Lukas Sommer (kde#340756) * Fix floating point HL, use the inbuilt Float like in C (kde#348843) * Split directions did got reversed (kde#348845) * Bug 348317 - [PATCH] Katepart syntax highlighting should recognize \u0123 style escapes for JavaScript (kde#348317) * Add *.cljs (kde#349844) * Update the GLSL highlighting file. * Fixed default colors to be more distinguishable * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.13.0.php- Update to 5.12.0 * debianchangelog.xml: add Debian/Stretch, Debian/Buster, Ubuntu-Wily * Fix for UTF-16 surrogate pair backspace/delete behavior. * Let QScrollBar handle the WheelEvents (kde#340936) * Apply patch from KWrite devel top update pure basic HL * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.12.0.php- Update to 5.11.0 * Allow like in KDE 4.x times 3rdparty apps/plugins to install own highlighting XML files into katepart5/syntax * Add KTextEditor::Document::searchText() * Bring back use of KEncodingFileDialog (kde#343255) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.11.0.php- Update to 5.10.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.10.0.php- Update to 5.9.0 * Add kdesrc-buildrc highlighting file * syntax: added support for binary integer literals in the PHP highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.9.0.php- Add explicit kiconthemes-devel BuildRequires- Update to 5.8.0 * Add word count statistics in statusbar * vimode: fix crash when removing last line in Visual Line mode * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.8.0.php- Update to 5.7.0 * Fixed high-precision touchpad scrolling * Do not emit documentUrlChanged during reload * Do not break cursor position on document reload in lines with tabs * Do not re(un)fold the first line if it was manually (un)folded * vimode: command history through arrow keys * Do not try to create a digest when we get a KDirWatch::deleted() signal * Performance: remove global initializations * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.7.0.php- Update to 5.6.0 * Fix build on MSVC. * vimode bugfixes * add syntax file for Oracle PL/SQL * ppd highlighting: better support for multiline values * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.6.0.php- Update to 5.5.0 * Fix kde#340212: incorrect soft-tabs alignment after beginning-of-line * Add libgit2 compile-time check for threads support * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.5.0.php- Update to 5.4.0 * Implement "go to last editing position" action * Guard against a possibly broken code folding state on disk * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.4.0.phps390zp21 1652332528  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN5.90.05.90.0-bp154.1.385.90.0-bp154.1.38 KTextEditorKTextEditorAbstractAnnotationItemDelegateAnnotationInterfaceApplicationAttributeCodeCompletionInterfaceCodeCompletionModelCodeCompletionModelControllerInterfaceCommandConfigInterfaceConfigPageCursorDocumentDocumentCursorEditorInlineNoteInlineNoteInterfaceInlineNoteProviderLineRangeMainWindowMarkInterfaceMessageModificationInterfaceMovingCursorMovingInterfaceMovingRangeMovingRangeFeedbackPluginRangeSessionConfigInterfaceTextHintInterfaceViewktexteditorabstractannotationitemdelegate.hannotationinterface.happlication.hattribute.hcodecompletioninterface.hcodecompletionmodel.hcodecompletionmodelcontrollerinterface.hcommand.hconfiginterface.hconfigpage.hcursor.hdocument.hdocumentcursor.heditor.hinlinenote.hinlinenoteinterface.hinlinenoteprovider.hlinerange.hmainwindow.hmarkinterface.hmessage.hmodificationinterface.hmovingcursor.hmovinginterface.hmovingrange.hmovingrangefeedback.hplugin.hrange.hsessionconfiginterface.htexthintinterface.hview.hktexteditor_export.hktexteditor_version.hKF5TextEditorKF5TextEditorConfig.cmakeKF5TextEditorConfigVersion.cmakeKF5TextEditorTargets-none.cmakeKF5TextEditorTargets.cmakelibKF5TextEditor.soqt_KTextEditor.prikdevfiletemplatestemplatesktexteditor-plugin.tar.bz2/usr/include/KF5//usr/include/KF5/KTextEditor//usr/include/KF5/KTextEditor/KTextEditor//usr/include/KF5/KTextEditor/ktexteditor//usr/lib64/cmake//usr/lib64/cmake/KF5TextEditor//usr/lib64//usr/lib64/qt5/mkspecs/modules//usr/share//usr/share/kdevfiletemplates//usr/share/kdevfiletemplates/templates/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Backports:SLE-15-SP4/standard/1341c6e10b624967dd590bc9eb5ad14e-ktexteditorcpioxz5s390x-suse-linuxdirectoryC source, ASCII textC++ source, ASCII textASCII textPOSIX tar archive (bzip2 compressed data, block size = 900k)PotQu\^'autf-8a344d1d27c5b2f4934f12217a038c14d028af3451d2b2a787fdd6dae5242c952? 7zXZ !t/a] crt:bLL &q;A2^K@btbZu^]#1Q/QjY=Ýz+fcSfT8k =ӅO\N]σ5YiRXZ2B?7vI$aTrk/oӅn.e%~n6j1.Zj bT;'Rr5߃s.$1[3g)n4 B+4\RD&N养Am̢5PhQ˛$SC.2x E@5:Yj6ትƯP__ߺ h\*S^ k>;P 3|%@r1XwQISb L?: _HxMᠢ4Moc4o5$H?R+ TCP2zpA\L-.a@E}pJrMc: zbP&tI~QZ9@RwJQrXE wM#<"z 9QwP6 >RamUŢ'=mL %{҈9k׍uf' ] r>[J+9>̦[d͝~S:d E:ˇsŠqG{75~cgTڢ^2EEcnRlG)yO5Wke6C =CEi|"g O^X[`TotuHmO!##:ߓ1뎎Qs { \ X"tO8jmmTUR:%Nqi+]A.ˆ;Z?T2 ٗ7mpotpu9߱HvEb5XD2^BM_XVJЬzYT[8e;MQW+6T|ʣ\8 (RK._wb+z^h-|nOfEq- LpD C 5(uvl'W+"POk??Z jBs=`Y}+kZ/~eI`?oޏb[;O0AffƋ^UMXt0I@qDnثiwxbq[X Q+l̙x*7 kQ-6ɜ(C-dXO&:iw,^|]䣮f+|^@0. x+ T-1 cP̧4F9t6V^^ ؕ#<)ENO2Co{5Hf6 VKo2?a_-e Mv^?TV2 b;;6-01rE-zB%y’ =IJB**ށ5EDL Ќ0HSiVwy]^΂WaFM5b{G5g#]&Hnp5Od?Pq){'`$\*CCkB,>:`gt:uC~f}F3F}Px x B㺺)Xn'\9ZC~l[z2^$|QlGK$8?K9}Ef O?ƕ2 U| Knzwٓ#jRlYd!X., .{~#a=՛#pw!oxnb nRV(~Y>-~y-w NN[JtR$C0/G?dHQ; yi.9sdf`SS.5%R DIu©Jrɳ>WQTzF0\ ~* ~`^xo1x\?ZlE`_=fH'fOvc7Z3KP'C[*xfGPᮨ%ފ X٭hC^CA%ڵuM?ΉH/E%6)xZ;дprEU Ua_<(Ծl_K@kqV,MVAmH?3 C`E0"eʇCa?ڡ)iN{ M*堑1%W]Ӌ'U{BQ8uYaAX*Zt_Qfw}=FΨ&UÂFme_䃯w>' ,\u+ܮ&E#{g-tF8AA4~Spg fu}72UgyKUԍ̺αOC_ }M~ꍕ;1ՕlEቼ*l8No7!ypBrY!]4d27&~ S0aGAҪ4}cJe|=-&I?.g_YڮzSA H;1Ϯ@YKgB9$t:/ߍ#1EeZ \cB<3;VI M?;-d[)@'a:Hl5wm XwS vJ0s-#:2Sf\G\ jPsR6|7/7͈?}•􋭬ZLr>եdjb]j@ z2a&eZ6˟RVLa]kU|'F#Atap4au <) b$o7 en ȕr*;YtxiQ?fIaa*כ5 pHNN3<;7\F4WG`-g|0U*lCji5P<$2zq r*MIHm[v,N^+>< Hǿ~b׏bamK0am8EPuJ.l1TG'rFY*l Pt K~+MF?elgM Ee-,O \[8~88PuB:8G<FF}1GAYH[r3E-"}>G{ Zv/%(I  ,"lw!otx#pM@\AM^K;`ʻb>9!IU8XZOm7+E p/2 "Q=:  Y<SQʑe@1~j"?du&p(۞\)>np4xԠ="Nx%ssxV>6uC$]LMtlC7?>D̑Cƣ@] qr#ȪeFctp m_՛#ȡ or?x/1P'!\r`gl1!Oªu{>\w ͽ1^3iʒ_:Ja,Q8_/թApGLsm;ft|2˨6gͱ ?"C(WHY870š"@= V::6ZgǺIu]Q^$# x6#SQܚֿ%ÞB(:8i:r"TGX ߔ@9\X dڐE/ \()&"))sY6)O*FC .TaCvGqW6 b}Bf-4} W>t֫^ƻ!UTyPH4"=[Ϭ/^|@H7{1дl[wJܝ,} ŭ'K=I3f[3#v[hZ+n8Z-[JˠAxHX%)̃/&??cSi#hkW5B5۷4-ܰ(aQ8r*gAodQzVL? +a#ȉ1V`5$Yv+EӖ}is$VM/:>\ .M Azo;ʌ [ƱT6XqAB~ \0Zjͮs\sms( ^G[ˠeU9' D$ DN@GnnM1_Bp->!x1OUUFFk\&| ~y*8VbX&]J2Kz#?.hq3NlxͲ[s^.tju ]"4I62H2-WlZ%Ʃ* y9+WZU*p@RRe9bY9qcfkaKS@̌Sͱ/d= zjq++YCtG_o[luϏFќq ]%bAHP@ oܞRfSyY4Ѐ ?bC,wOWW-Kb*Tcgi-$A )0jk[X0#wn3fLo҇:7'~}$.Az1+r[+%Np~FnzPmeA>PYo`F㣌*}oPz5f3!!Z7Wgm=;L.8m :*X'o̬>䵽Ӓ|O }(o.7AqjbZm깓s+dQY-έoCVt iZ@(9Vp/mV*bHիէW^He NGr $)P){"m>BVj/2Up^cfv.>9ddڏb/U6ލ%()TZz։UFmd)cՁSFzTƠPe׌`R>A56LaD!&J >}SYB{_]=ykLDoܽ柒i;{$#@?}cƘΟS~Yt72qՙnL{J)>ϵ؞ʰUA?ޯIBocS,> $[}d#q.T b^DR阮*ЧOа?MB^="[w؝NK?_l#74t;A6Ef8EU!|VeQ3@05{^>Р3KJD(8:]$,Sl:m뻆jŦ _MS#A.d ?̸t_iIG<_DJb4/8B0S$lľOٸ$Q쎴]oo=-I2onb7'~܇cz6PZT_ ۛbRHg;59 ji{w@"]}&A ҏqKÚqo _rn^RVzuPfICI(W8^򋃳ILJ1.eg# ];QZbd"ağEl$5VtVp,p5W&za#Cf pM2p 28}Ǹ#-M/"!>;kx }T8vT:>~Ӿ+ñ}d%P'לj= `#r%WÑMBp,F" -|h'neNIj|HSUz$w+ˎ.xEߣ9@a+]wD)xfx~D٧gm JTc[am_BBr:21 v 3#aSϦ W7Y${?N<966IV08E~)vm  LZ n&Gx|xa z Q /xrQrF€geB 7#FG}HPgqG@q2HI~R-b挄U _bL(,F=h9*X:D@< DoX[K8rG1.d|ISҞ&D9g BFO6ڐExCZe*nLl.IQV'I&z5d;g<6mRS܎SEqbN8hUrxTSͯPfdeL*S9uVڠG~J[`\:Qy)r5U ,i5h;\. S/m(@&Ф[z3zmfk{5!q北J3@'eל8z& "cs> q{8ZBl=9tR$:[G&I P˾e9?^KG9 yG}h 0î (+cVCn^7?J*DE1^+28xx(}1BC{T,` \S30$"(\tc |98ZzeC)5yD)9s壷W}Yj\#8* 2?ؘ|FeMb-ClʝTQuVc9)d;-pw5h]ek3-QWY6KW'2Au "p4ot0& >$k^3X/PrE)/=FowwS+Tm֮wzl/xeI@QՐ>_Ubvb&${=⬊g<%=Q(YɦRB{.q'ȵ/v} ko/gr+d,Kx3 >eI}8^_d5&fpFmSnyTZ0 y}oP^ey"?/婚)TyF>u+_YWZEie 6'78QВ <=,e6k?İÄ)~\lYOEZ%."EGRt\wOϾۍV@lWI ,F)M{m*pN{=9']2-S43Zk9P7/XW2|ה>\!VdYI 1s!1C&4!1O0vwLœA{?g;їB(fJ{⏋cciczլ#v?*1lg`+8-?(9Џ)m ؗ4Ov[6Xru+Ew93xgpt`4_& ;\ -p,Bx_Sw=Pa TJL͢x@ꟳgH,=#.`Kb[ս ㇾBI:OAFnWBm\_fs'Y3pd>[Dbc+ѽq}!8__g  X4c'n?n9p&D) u)R{BtLiS'bë'_q[cFAx[jQ XÒ}jT1VCVQZaz鰅(p3eCbde3U1~&}M 壇RsL-ق~x}M.WoVȼѽxsP+P) w2] /1k".aY%h MnEeT %-晪/GV_mҳVYL9rAq-$}hAи Lۢ'eQDT SfPN9$/#ևMySѫc,v (;̕X\[{agrKyL,0(:UUKe2K=?S_+V6hf[\#k_ N~:ƨ>?RMniF]Ž\푂.yr@&6qGT77J0f3*Wت T;5ke0JmX"QcU`:#]WWyZ~%tXHr-w}mgԈUpNK1\ch>t&&mj1 f`8sR\zJ8eDw5i9Ȗ~tK8=RH  ֳ?R ̨9On&C]T"W=E2ayg&nY[P].G,o#11IzeȲ P\{1 "NJx'Iݔs:}dOV\GO\Üz*tBI~,Z0'=޲ݢx'',0xIK%/Uhrc)xc`z cvP\+ӑ%O2uKAO>XA3ptAk^;ovi)&(!8e>o5ɭ*`ԗN!ؖ2+\[%8ȣb)G- z! ; ~]>ĕx/Ld"YhBc0{|/+ A$`T*jBS"lu$҄ȋfG?AϾe?J+tm ,-P I(lSixf;%g~06 1:D];ug9Lq=T NP鍴[Ț3Ɲ4_E??-w|qO8mwy%lb _5V ?k d6Dz3Ya jVB-6kgų!q+ЌF. (.]w(c20 ią jdcwuq A [d0(r6͡a n6(=4*ieqgzqY:S*4}YH 3ZvFkRRi+*L&F<)ï.npKaAZ/|LY"n8LZx a wǫ4vJyR7G?}j$|g/[# ok)Bbu< Jnu-`(L%?$ ${*;[u vGT&i%"Cq=˱{e.n]kQve8< 斐lB6\ Q~&n_n.TSlnElU4q$%@7{#VxXÖ?"42+:uKJʆ>9jxM'|BN4OO1-e*;2;_ܗ MUt r>;rا'i|q7 cX8أȘq+uəLW|D*5/N"ajʁT~ Ͽ3h[W΀E/~}%—ԗ;@s?}&'03= ,_c_5<`D>$W_𦉔nN4#+ڋYfGB-PzlaբZ]&wL Owd Tm!🵜!P=}iJэ0zax':NNT)݅Wx*OI7DO灬04~[C;Ô=T=W Ek{돗.C4df)\oa]?i$WQt/Fg?hu VjrPrW%B3,@)\D/HR!a},[+Cut+)V8_j W_U8Op{7j1YĘ8 ~ iqL1 M^QTӇTm8ϳh\~2QyfAtN 5܈rEqm}T5h_ ?M{h,,BoEt2P=]QG{y+޷A9?SIslǸg' _TAeiΩt/E~z昺C]8wioy$yIdgBؠQ$(Fbv&"x'Q>!xeMTwR4.YL\%;w%ǀgE{8 OKX®-ֹ>IWh{ݠ E lkvLE!DBt"%[Õ}$TxnM+s9̽N8Š gNR'"ڥi3R&4eʼnKT'cu2^҇$^ETC(K3LɟIer#Gm 5ZIòԳMGwN)%FNhBȝb:D2u;u~P֌X/? / }MM9C$۟8{Z9&" )T!8Մ/X[RH39" |7LG]R֯ ?/m㬵#B&i|Y/q%jq7G64l;0/o?MuTZ放*/T+%@O.$q^/C񐈮#::7p[8-)~S`>S );pq. ,prNs8C8MAP &[Jt*%6le_Q;/0/ :?,~ Dih# 'CxW1SF)X"M۰Vd⦵ze/yxOS룹)e:f_cݣОk,XV޶!x;S&p:cgta;o;1Svíh-~\sV Y vd'B>mϾ5o\W"Sc|+xLIǔ=H yrbGYО^ ܟzI9yY9>д4҈ĥaSc Bܧٞ)1j>^YOzi 3r19m,1aij۽]D̘0Tوu&0Zrh`Yva{pWV"$O:ߋd8}2s@Cx!mg*_U\p/$գy4@3o9p98[V3>-UhDfi4+blD?+^dᓫaɠr=*XM*#%ΔݮWY[ʏX1zӕOLvkn T`^ 5I[1}M"kBRG~]u%#6%Jr췑 0Pp_OE,Y]HzhYtP tMlj,% · 1gp ՏmzuՅi\D=E$r锴b&LF-t> DX$#+#}ØthSs M:(-!JUQs>h\*YPQ[tDCA"tUwkLcH@MS;2PC2"~1JU=;v+3'$žڴCdZ\yMJ @ 8/Y˟k;&oݸSB1lDQLLκFoѡA?le6]]dg%A!zFcuuXD?'$8qW5WVpc ժNN H;Z^:x]Ew[i"vk,Fq!ihd*E'Kf2)M W~')}f(N'Å|tl_/InIG%*،a>N(9;\g0~sDpEJ|B5cN+5o鱼i*R B[n8)~<}qCT~'L|u#\wIGC~;6 ^\ߠd`TRCBf'Xxb%,2 A􂞃##lUʰeTϔud36 % K4 = mɶE [)!-̷?wL^lHdN$"#ײKq7.I'DsA!-.T\LPs8J}QQjZ~Lΰ}-[qܕ؆^.? e@^Xj^L -0wD+p!@٨Ӟzh`5SdA\BMo0Sˆ[*/VA4z~>i|:}yEĿ^x<8:M6 =-N8k$ ۸|2LE9$տ #:F'k6lR.ȩ)` zzy n͞*x%R3@s+#4 ,@P)7?FH2 I2!VC35] 4 YÀa-^ʱRG$Ʌm 8L<X`5 P\MPEEΡxFy1h=z5?7ʤ_2ˍlٔdLݩ3cYZ5[,q%$#Q2 C=' Ȥ~B_#ۮdE3= M^b&&`7E.B [M^w\8xxgZ`f |]Kp졶Ilf'=cѡZC49Ńi8HqZݶ} c5T/DZ,\wQ' 8&x }I{7u(8k,Pl3 {,;92 F>uGو=0b$?:1')TS=QN!ۼ b8 a}p>dKoо8m{iewR?X.?FÏC2![xRhλFWq'[@å,_͡:ߢZ^\g'prYH~!{Bl+ ix0y8mʙG8huu\o 10a힋e.N|mn:Tma=}%1eaBmbRVf^'quɰv tΣ'S :e@)QK0#]:e|E ˣnᱼr'ȓaWAb=D|T5P1]rO uFDiH{#"QQlkn[+)l4y6f(9LtG`yWNe|lwĞֶ= Cw 5Ei$PbEC11K<jY'a@)r6D׆Lo._f_[HQ y~SFߌ!7$-~v4t+~IQUOpgOv )8-3.}p]& \=^1׼;9鑤!is;_]8hqѥ+㞃XMOz $|BH(ԾAC'/P:m'^ P,U2UZ̶S5&z3\Ay||` bѰ"\H=1|^q4Μ*$ciq"$U-` F7`u۲730,X'_,oYJCæ}{7}~!@k9p[G>(2ďqmH?&&[dl+bF-2zY:Ժ 7{(oHZsY@$(pW,`ՠ Յ3yD42h^W\:`FՒhx,W!5?F1e'~)/ZPԡwh^X!OW|9C^ȧ%1Ww1cK.wE%>~uÐrv/G΂)G?9z E•9n scXmoFY$tosGe'L+4Q{*FVipEJB)qݻƈgqtV6a8=13 .\2va {Q%n6 U֤JIO$8u<^#NXv({S.jA Дï(m Y_=aJq9΅j8ԥlDJ"ek. 7OYz{dNFVWEhorU9X ^9?UCfєcG0q"pGE;<l5jtW/]Q! Aa#9zl{LGsXUZ#n`>Cj`j* +`rmo gԊ;ͺ7 )Act!ȫ mz?3HlVMn:L!oA1Ǩ,Y,\&,uQAf K^OvG*ޣdX\VpN[_ssq$wjӼm;.@ss5]lO$DOʱXڎ4tFH\SGAp/VۀxLi޲,r RpuTLCXigg?sJrA>׭]GUFprɈx?lK95~ZYKÇOZP&RvVLL!;PL͛_xv؉S45>^ERi;a+(+9XQ`㖬Uq 'jSxO+QIVv ϚF1 i,@XN;a`^cg wDzSP"e'hC-WM}/6(U'snHh7~ٹq1˶y!kBiyY؈(!{kQz4KI!TKL0ٟ ު!kp< XJed H֓w5A*azB\ m낓=9a,B|' čG 䍫J>lHOSvFzo=)^N7pw쪠!yм<̜rFbA|ΰ1% ,P2../30{Ly(Ƒ){K&#`ɉub@0.=ƪ VOIX Zl LBLQniHpiJC#8pb6>ӷxjQ>]/Yk]گ8FޡOmGxi7? w`"wv<8)ptUY@d"pv.ܗt]4R0cpQqCDӉr9ĊhR /KL fd%&@!0ZF1L8*5`8ȏkt2ʱ7;xňau멵Cg&djeƒk̙ Zr NWI] (Rؼ$!H`$ NitpHѱAF"Hpom6$Q~V8>; ھJM!W8ކ]Wg>Oj2ymN^Fz\EƁgMIc쳽-$W0pcX,`ưFݳp61)=Ӊʳbև9g~']f7L좠M(ǫ]RWEe]9Fg)y>EYK!hK OϕbV)šD>V@*ؗ-P+Gh`YQ^)_vnS!7fU}i0W0kbs'˃9M yECꀸ#>KY״\DUbH4^}z2d `}]74uQkў`y-~ZoE=ʅq /}qF^ ('D2q<\SHf׋ #{ Q o(j>"KH @*4v9+v𠇖ܺiBmzvQ/n}sAd#Zż|Z|bLe8w)IP i=iTgϲSSA1U,AHHl^׫hb;mORBi˳!=o0s؂$GߔQkC^ĈiZY]Zao ˰FZf({ O"9$۝ҫRl!úL^ET%L:`_ߣR@*K>cC+@L9aS.yjonμXgjf}=-cN h~-Ôt*LXX 1$UьSӚ$%?2HoF$+^Ş ^{<,z$f$pVaRj W-4[K ~#wfӲ9 uBiṵF:y֊B4&"a^ےsa%5 ר8#A% !zuA۰yfmj{NcNw=bs̐uCOT@ur^,>s7[N4bsBDhE/򚄀cq]?"s70Y(vZ oiTL DIgYV) .yΨO`D1ոSm1IQ~rA֔r\dp:L1#u9 /%^ݠ&{~l9noxbرw6=K2թFt6Mx A]x AB%f)Ը;ۈddп5D|jȾiVFnUQ羢yM4o@Y⊝Wq $(|4ܻ% V*q[TJx5ƯߡdB 5L7@ X0Z x!տ5˂6$njUB4L6Ɉȉ0)T .O*Xl?L#9\K.|6f8)/#dF] *8FwͅJB(~.JrcpjQ褛w+лÜ͹S#*Oe_LN`EB)Uxz-L/%Dj ~> E7/ &nsYQf0R潌-P^&#ʑR4x^{I/4r$"Rzfc;[Aˏ0Ι|SiBdNPYioShrˡHrf |AZ9kdMJ+xtdCЋܽ[+cRBF [uJ>Ca\ؔ46 7o/P}ׄ@z"c~pac~"SN0ce$#,_| ,Ȍ+BmBeN}d>WyLtZc9{ϹLez Z1_*I6#ոE !َEs7ԍ#'-xqzB PpkNc3 (N[?a)W=\g  F@7`g 5mPW S!k[G2eO;g/3ijojж RxJ9PY( +sL= yh ػ'=87FV.j`X.}v7x1nꜝ{#naªC/D{ʴe'H ȣ4Fy\8`kY呣> M ga9򪬎kʏTu{*Jܮl|N G.`l0zXp5ȴqCˌ{o5,C ;_?TDبbMD28|a OtQ^z.GTP>dIw[w_TvIO] fPni4; G #A;_-! ˮR3/QͲ2%B؂c]$/F=xqw3.+XJ[? gYR'oTrtߧrH䭹ZK¼FB9gϥ(Nz{"Pdox^ g< ϛ8cЇ -˺3 Xmw QSeKſHY|ɖK͚\1!vTڬ( Җ(g=bCTmD"/N%ɞ?\j?k} gօ"n&* /b:[Zq(Uت4ϜSSb=?LoIK6NcթR P@y[Bv,}N@JšC~*H t羃u.Qt>%"˗}PV6)e=ah |*3սZ4+w{$?P3aA5Zm= Gv *@@/kY.ݽZa)J>5n}rK@~i6~iY|: _ y鰮)L mPzaty,5V!?d_ɀT@QVƆ"^M{NXBNJٴ}Jy5R(/T?%:P< qK_(1<XC0o#8:tZcMC ҋDz;EMu-Qq;e"2"@%:H;@e`r涋˴Nc!PSIh$;+ TE4mU[O<6uZ9]'{a:-dLFہ{*\QR1 Au:u|"gH M^Get9"xZkB8pe?1C+4q(6d|\of A;͖HoTvfL$#Nq>YG]Xr*cֻdPm\ky^]%ng[> + ?5Zըw!wߛq١]41[iEk78[UZ=10^&'|In+0e-#t[/Gr~s3ju*>tDhf*qTB/l1,M[ǍfKoZUo~XDF&YCX\Ζ\BPCm&4`9yj"WbOVKJF\RiZĶ͡Nk]+NтU J~'MU}= y"9Ak1>S! gh>;U~54$T @n^}q}&MK@@\?d{b; J;OZfx=o'y5c|&KPcIk9LejaFdK6I-%wgHp?p 4y_+&.QɢGܯ.k*EξPFr7 CwpP3&+YVΚ6DOFRel")mF(O&]K%ssAzD!mEpEqWa-SuoNyQX`&_GF ~q$\rJ+@C6^l[20UPq)*&-3^o7Ƒ>\:TLOi"vC˽FTVoϢҲUdMZ(W$y-0ek9'ܒhV0e0'9Ӽ@d [Ҿf傉 K Mh8f CZr!t5^qWl.G?m:,ww*U9g/VE$Фp3'DMErWukžcf҈B]o3q/sn"JoJƚM_%ǯ&s]Ļb"j=&$7,HlʐHzW#]:Dկ"4lEnXCzLcv_Q:L<;9}-X'I3Ow׽u[jjQ!\@BʱfOLbu;nqEb̾s4j~=[ӭʄ%yt i?tdyYlⲹ)[)/lmJ֧o>! M"uYCazI neܤ+*[ Zs$ q%gnv̲BRZPtD*ڇaX!м= k^Lu"EK "3\XLlp3Uڅ_YC+[6-*ȭ&O1 `!(]pö_$TE8ny Js(ژZ͉3^ N?pݷ̦ى߰_TLsCtF^eƟa׽Rߪ9@j>2n0.]gAT0[1h,IdLL3!u׫=\P|Q .j0T.x73.}*P.Wd`jtz_'+@3ZYO-0NRސco"‘_; 6Y[k'|3C,$( ^xO2W֐ܖWh=ux_LhQ&WWm磭1A9<}bW9 @5e xfXkGcteCNV-?NGvEhо=%10e& -]U-l{o7Ҥ;Rdx3gֲelK7MP~hc;y+GƤfqlyn" p)ͨM2%: ?_ೊ { d-Fl8e1%&N3YZk&T价 ;slf6zNnf:b[27W%W7p;u$INxH':* ~7soPTׂMnnޢ=@k|\PG1Q_vq O܍p85nnQBi2GV;h1vzѷʆ~j|)g%vP+05Ef%q煷+(C,;Et:dG0jy괶t>7k T~`43hyE S я?$tGm!YmÇnq02>P /n-5H`dPܐ"N,M^?N{`<6U}ķB" 2x[1;;v3;=8C;+_SU٦=v`ݞ9{U⎠*o2(٘@ϊB|Bk7ԍZ }!#紧veOEh6)6C-mkp?:O C7do6~1{!ir/SB$8뾖ZBdLi) ͂5/`Te VͲJzх2:{J£ bPeٷ[δms͟p՝nSp<(=NKKj>CBS8"][W3Yrc^\SE:>@//-*ҫJXUYÙ\eڃݴ?3~t).y`DTmjޜJnQA: Ve<`cyjO:*)A54arieSxq=S@f`ycyUpxSvQslHĸ?Bo+Č+ 3e Ʊ?M)< ?4T?5>[%meDjAaTb3.z3:wY$}hyel0-7J~ wq?f;GpZNQg;M=_W+a%h!]$KsV>H!;cehBs@ݩeFWZ#ձw~.9ԕ+]+ɣ.|Mc!Kf|˟Mr.FKn- k"jlxM\.j'^c0˞!Zx\%W!_zJ Rv C:U#Wn~F腾%Gmp-6<_PثOK&kX7ͱ&ED$? qL+R^?"|aLWL?;:6/s'֔zrCj' fڄ.R=~]o\ ')v>J~;>{3 #04uYk:zA۱Je& z JT fN|t5>l Eܛ|6xM:r>gFһ .at0额 P*Ȼl.⤭ԭ>T\ϕGyr~|W~ԛgqak!!Ӈrl 4Vyܥ5ڦN̽%N!^X?g򯝌ֺn0A7PBv@m$K?e<#2#&,p#;/ܢvIx0p0̧>t>L`Gd =J~K z EFIu^sik̟-2>cx:Rg{/Z[ nlaNDH^Z7id57]#" v^G&?F.wVFj$L(?h j|j>i@mrEϼ4PR}KH"3Z/f#8n~vҘvpݛ= NůGkBT-AV`3v%j Eqr)ؽ3+;`|r'P>`Cfj8ǮwdAke6#6S<<2ǍG0 ZZ?&RZ[DFwV'r:)caxbcҮnچB7LNuãsM<)57$ MCHYRɍؚ=~J ֮wmmIԡΥL&EY%'܊;M&uC8pr>.1ᢇ9%z ʣ#޼tiŦLfTG xG@+áPdZshEb7۟͋Q"Þlb >pÀ_ߊ !P6+\ϛ,8LTYfe/tdf8BϞ8<:-ƺW_h~NNo݊ {.5Z7]G1w5(K~:͚sn"PB8'5W5|֧JkKrKu ϡC4dMP_o}|mYvf?U{:nsk oE?3+ 79pjWX vu^1{o cH1ARYI9qrK4i&j;3X>O:\{?;C"rOmb[OfH*u}<x [];?@78[g ( [~\~RwFg}L6bYW@%UDKJ&0&֞9I;mH$1Z+WWRNa#k`q1w`4Bhv 0}.::},~I^eq!%ͧ*llc Dъ Z' w' ij2u?3 bPdW! z}4yu /fdѺ %LXSAzUcE<~3u DOT7l1 Ci)퀙8bwJX"z+~d$r|4EuglY3ZLPg|LD(Hn#YD#  qy*%*O&|痡Js30| $"bu송R\R<Ñ6?W]ҵ߅6$a/?|2jܺp!AG9zSocKd}lDA~ҹP!^_c??%Sf? 䛏+UX.y T໭?)sj|J G R"PwKmWW{-0$vI:% ;k&18OMg+_͘m]r-g8"cROo͊z`OҘ˖:[$?<#^GĄګCD#3{P:8=?XOx2?rn/b ~q3:3vzR<%͛-&Gݍ ɿ19ċ= hey"xkȵbZ46SE8ފ%qc` 5a@p6 }{JIfh,6aHNkܖQ]ڗ֭3v!.͡ϖh:>iq.eV픔H)'',zUyw}bas@+ӚPvyFQ=[|^$Q|ĔRX`|aѨF`yޜ"AbĢ<ߎkYXIBNkv&$\kj6 G_18( u 66:y*e7le݀$`"'fXiЖDa?yb-1zeZk^I 3^ߴ>'="ls[H=A}m3pSq)E5շsVൽxR_!tgm#1`L5W/qS)÷`fٷk >0$xl!k@Zmǘ'AjDR?4ސ㊷F6Yk9%f`?u]$nYLfcn)WWo@d//(o\vnAk ]?*+kCCCΤC/ 񶍘My7kAƧb5HqIVm1 !n|4b؛Y*MLPRWRiQ/#I*8jC& CR١,8*L;Bs!wChcTf&4"TlDyk7 d &5ED(^,,VEg_={to.~?;8L2|zmAJQ)U-}Uт9qGZ]j.1P^qǃ𷨽RDz)>뮧^LPU;9\|@O*:YAyV- LyNYaS-u<׮*c acl!<֮姸k蒊RNz?fv@eHaM{c,Ƴl*~Rx{@KhԿ^) tmO @-d6G vDV"w(A$JAR|^?Ҭѝ {/tdzZ#QSȘa桪sqQߊ1Kʅ_w'd-qu9q@e$ @C6]{ !OX,cx/fɗp6/gUj V"!:cu kh|NjQt(x)rJq2N= ڛ  qרh%GmRE`7,* IQ Qյl,om@!$!lǜ#'DBPI3 iឣLKkU 1l7 ="Pn( fh >ԻwZ 3Vr]kZzMxGJXW&X4[Po_k`՚Z{3o)H'qr/ŭd@leSf+䧂*"::Lʰ&;C+̅`Y,J2W…wY5E tld /^cd'GIyEe(>@zo[FS~]Si>9V"OddoyюrͺYAz<5n@N-94ˎFji8t!VӡgxN:' QԯX 2𧿾7w;1!O& ym QJwp5ƱVHƓ142)̧\ qd~oi0MuP+{^l+PT# \JPU\&ħۄfH~:۽ow$P(Ғdwvk{&oLm48!)Op>x&}ADX]Pɭӂ@

}fNTNIJ/z~St`<_K\,oB<@&7s5cbx0jilu@;lX{,_=ӎKBOaADJ%Rs>Y)رȮ&p>gZ؉b@HA; J/ltDR +0"oYp9;e*<4S_~ˆLzX^43_<';y L;P?hdOƞWCg)h$z!xCFKmLZK0\U[\E]WZ};Uu3qI@ L@q]'$.!<.\2dk4& rޣxG*,CoJf85XMB b 9f|( 4: hYhbRyS1l1;dgNl}Q[iҀG'~nmV!2^gJ`o&@ k?W7A?p\-Z3INJo5\2f@j\ 4Yhꉏ =k\0r[g9+x_ Dy^WT( VPI"k'eZ·l L1ɔ8M=cώ(N4&Ѷ2"uIWCو**T,;g`8]G"a|d%4"w/ 6|Fgr1.e9O\?$bH4OB͊`g %d_rZ#J*{G(7 {XUA_̳- Fƒ^ rü\<"02Ae}eKRh<f\Q0>Q8`iw>2䶙.)~.= Gn\7qփ˞EGbqDnU/`EGgg}7>|T TeMb2KG+}>BX-Z?@끦ԥ+0@zN$JiGyvUæũop(zxN˂b|Tp Wp@S OMH9~rSpw.zTߢ.XG;* !;alm5-FG(lM0 ȭ6W9Y:+[L۳1oI|$r3-Z0梢rtc2<#9|DpzNB?d~5L]u&B:<4K'K~%o'v>*_Opf)_ epծ/~ qDc15N^$'}j93CI6:Qx_aߗ9cv[͞D]tnػ`-N5F9HM1q!~xf XLё閻P|Jlg'B W`~;jA W[2wAIa}#t=K`Ӱ`,;dP x`Ž/[[095?;knolOj%AxJ`ϣ.ǭxN*hMjÒ[yv3iy-+0!ᡶ= _{[Ru$lEt ]K od [F'>ʊFF}Wq8?>7߫Dgirste;csɒ\ҏT-5^zؿAEvc)|{iPOJoC4 `P(8;!  hz(SWFd3k7+I,ؾ8,u "eRn+T W92[k÷x+7W~{Dp{A8l0]#A;\ɵ=̬AZH E [R?3@1͑mbaQ9KK+?Ӗ.{\5֔s"&*kMkzCR^~ܞαMũ-T7{Om$5rT3R#'L+"NZ >U8ba}cQrWs2<`.3> eO$AKPv7ALiC&kJq49I>̇Ȇ1 i> vmx,vXPzhF-M sy59%r˽$B-.es_e "bRf giþ[8\ ݔI*՟iHGqochk&Ee+L"uX 'a /*VeMlʗ}D^F ZW{M ­0mig_vXa$hZl_˧8*!Tm)PIrDڻl}<%Y"IOȭU~-TdFj<ԭmH܇QR_@ZA᪄Dfd*\%OPneyttn03WGR":Aꭓv,&H :''* Jk ͨ">'>JЇV4Ɍy#BfBEʤ/EB*OBF1,Tx{2 BtOdk$2u!"ոd-EXi:9w4cκ<4H:G.02W!@ɵ'*5#0/!P@ vuU qC]@*.\ۀ7gf ;2/d8f?XVIKbqUp9? Y{CUt`?&+Դr?k.5Bѵ/CN_L^5j`CӴ"w!.v8N']BS"+@?AOt _ֶuj}st;}S0Uauz-V bΡtӣ6CYOGm z&7ƋI LK87W=tXz 4ZZgaBp ȿl^l%oه0eCW_мqy 4nM8^f\&zc^-@)+.-/v-}TbB@C6)v! O81uҿru_@<ƠV[~0TEukx| k#*~BG ! |T|?"gy:13j/7W Qr-һ3Ѫ~~ɠBZa):L{ j^;k7E1U8re[w/Cݜ ʻ+,>m /35gXu JRKkQ=ʑ1:K n%|!)"d>)fSQ'2:QCIo9}wg-ĺ ނMYNO骇,蠕Lj{ErCf] |ҴDdno+ 7z.)f2o<ʕCAḋ S}>]]EB B .UFs=LYeL|ߵR$Rn DHH3ǒ ِR {qcz6O'&X*?4`T2󒮌_kM:PK(/G9AҸuM4_DJؑPLk{+,t7Fkmy~_}AU}OfP+q7!85 id>AI\_tz%JlF/)w5oVQ|l2 nF ^ZԼûw/Nvr@G>i="y3K Sb՞h-Y" ,"Gh8B[Ziۂ/  Dw⹴k{:kK5}JZ/')lt4)%ޯ;JpVda-P]\"mj.0X^pKAI7:<+X.uN"/W]xPPxｺX>8J` Qɔ,kr+@+[+_bnIl'~?d>ݶi8$(^|mzpS뫗ZIPTS^eu&P([XS!!h-9+VsݘQY/Vٲ~]LŲɄ C^73 iyS(Omd^k*1N9a%lXa 846Wd)ŮHlZ@ٝ7{>sp|*~ϩϗ|VAEР! K*#6wW&.*1psy$#=?Q[3A vZV ueEcL2f dΈ&o[0T-j'Rq.O0|̙ͮv ג7]X)7[eYb=m[eQnxJbWC|L37 L;&r,Img{;aww*Y)b#y!^sM!<S~mYs%ht(_dϴ9L[ H! vT<ő^uo'b;A\r5 @c}ʁMi]MΜ3nn>)٠ q+I3 tS# c40K2̵u~,=kjO)ܱV[d9 Gw'Vn6pu:@ĩTmyS?eUVAԽ s6y5QQx2ʎNs.m L%"{@=79r7(s?WܹP` Rs`,bcՂ }p7jE 1Gԥ58pNQsMNs&2+s:;foP/u*y&l[_vGi[̅R>RنG}^1PZQ?73Z!x\5՟p?0>Fhت0;} (90Y!scRm&# /#'8+gGw&Ft9Ԝ ԉ\';|, "6hȖsqk+Y>[Iv&gumH"q݂9ȓt'n7bkOu,XiEoIM$ސE;Ux(!=|c1noiXN|QO[)V/b6tۙFl&(Kz3@;"v)^zH+;C'RAGkJM|(c:ۋ/]:)T%'iw Yp,?֔D[erS1_Xe6RO!J>?I6yk)DLcɹސ=lۮ|R3>PFw什IU4 P3"*)@&l6SKEŗװ' >7W>>{|>0g-0RgfZOE=ƒ̦>Ail|Sw>^N+z L{F6WNdH|"-:VPzC^`|>&Z.=%$u|#qD706:/l6صĭj4 E =,#j=7:'&IYVT5KIu.{uv-Q&cNH uڜ&5};:êɁ~ǼαK!fMBd'>T`'y6bG:~t0Jc{=&~sB%DI ipl3ϥJJsR}q]T|&g +dy }C'4[.+[ nv5"e7Ew׭˪|?u:m1Z 80Kci; [I()kfߟtxEpSWA /Z|AuTCȰT`Š?5IGB~[-`,>=t_1YWB8Y0]cʑH3-WG}|+oN6-PaSusCOÑџ֥ޭwyp\Qvۍl1zC+K(#o&٠ÿla$FkZ 2Y{hA_BgNqzD0!Ʉ@tc0?a{ 1=ZLFŽruIBϢڻؓFz,!wn F > _ϔ}k #}oVVK|m&A55 CHw&=|!̒Xum~%?RIR $Di /-^Ds>z*(Cμ57bTyvP9|n-KO+8tc^[ci5I" 7^k7{!A#Hx'βGx?G&522`:$p$$'Uͨ.%᫫|LqyF0őPNQء/ڂYSc\$TU492RAV 0x `i,)ݖx2U!:- 5YYu |pU.\g38ʙ~60F V:;j_Pp sM(0*}-7Z|o*+sb #_%zt%`"G<q)D1Ŗܣ1VX0P+Uj"TI= z Hw_cjUdE4QȠmBXiVw|.ܴ>(Xml>naڋƮq >B7JK\e$v'UU!0sWc& 5/pTN0?ӡ)[.s>{un,0Ǵ7hAىylyģ}J,Z}9LKO(GmAxѳq'BMȬ “DcWU[#Q2zkE8xU&N^eYyG}`XdhmKlBЈBGo8f~/]2?t("9@xSI{Nl\C&`Ru_yfg4ŷ[v 0UgUV :Fu(XeSe+N vDscÅX=`խGo^U-ڎfS&X(B~`u;Wfj搒l/`bW,WG ë:@ ]-CϘfO=/L,-l}q%+1Vu%-y2RψIv2Mo2v!,. TWcŖu-8sd7¼몙F*ьV=;hz*ЙAPNGeD uW~wFcДrk:ʖ,x)q^#WWbA!NGwHI-BȇIAIſ>̟M(!LKo~ARBNmk#:@H#nH8+ V͓6;)CI5sYVeVuȇRբ6Cd _/ғ >qIz)ō]` |L7' {o p ur!i^fcPfeK[l(x-Rj%)va8Yfe6N鞯FDuōg=фPI)(I=x"}R3Wn!Nv ȣwY&r'1Qgi7dIjӴAg2Ecìw{66@H#D(9 E  Y&XQ.Q\A3/2V.-j#D,ɴFVQb *73巤|G}OdyLaGҏX'N)7oF=+Nly7Y@CuZ$ٴFuz!'Fh^kO@vp{{ǘ_$~~%Z\ %UsauhcqO(v tj YNy/2`7]5E@}&;Gե3I }m[Ͳg#5zJsXӅy? C?zDŽ*ZnHe`T\6oHZDܤ$+hehhΐ6tPC>{cK869W9H #dvN;~ruYߔ^͘C+BʝC !jRڠH[Ό`<%2RG0Y2$6A/ {eJٙ:,MEҐyb \'}`d_A͖Lϒ!d/⥩e|TA[(RÐ L6LfOfgxmnik,&C(tr}G-tDLNKZhiDPM"RTO.g{P>ZE125s+}5k VEsW@znͤ%9 m- Na'Whƒ`J [wk}\pLԋ.out\զ\T_ΰRE M .oшl3[Tt1(o'(q.FM-spS6?z]{$*3y֘-W\iD_;Bmm~80P^]sNGJ1Α(TҴPB@hQrNGN-;*V6~<(bByճtJAE:Z^KlJ2:Um7@x(Q/gYpY[|(Y%Z *Otx (KʮMinT* [ƶ١ܨҋ2]ܒLՏu3'_FqҫG2l!UB%+}-Ӳ(J3|X,՟IW)PĄzSAEYV$b]6zQuyF$FE{4 pϋk3 ;ߚ ۺޛTئJOw{Zso*Y3FDrAww*~_xoa3)u^QC踛D\-!!"c. <4 ?!;6ۍ*\T&T ,N.WW#KL"o.ӹ1 ]Wek6e%4JWLu}bh3c4@bޘJoW> qxE^9œLSxV>P%N?%yA*(|4iW{Z,z\ۜj)kJgftYO+'2e$ݢmK,Ha㽄$"櫉@f['FO=Q1X۰kjzwC 7:l'nWSȉgLs~L(,iG8?mk$*vk@ AZ9k%N ,xc0-|"_ښN!c)>?r(= _FP rz{ap'P?úޏ#aA(*.)2i5/qԆ hY;'N 4dP7#I0RS}u%2\1:s:)y#(f.^IG,=l' t=`녹-\GhAŶ6 jG pr/hSvX0/w|:^^&SA:>O LA6C+I^jɌi\XuZbEv}&&˰B#<%Xՙ.nb ygac6L}ȝ[~p(},=aZՉj|a~A*6+q:w14z6M]P&AlT Z-^Y8U.nnk(^[Uu|íLn$Dِs KhGq6 \kEh\ Oh2ȣ.sAq&uPrYZ5-&tgn7ˎs\#QlTڕ8y]/r2KHTǁwEX۸z? >),(#1~L{͹UMK^G"8)ŸRE6jT"<(ޒI5ɘB`K% ޮl 7oi0;t:og8N ;SЂ>* ڃ4CH[_ufsKa.-W#iI1yi򀿵S 瓓ٶ51yKJf$*=pRCQZOWlہ BZ=r 8= Rk`72!&ŅjBWJx5~vdǰWR~љ,ˤMgSOHMKS֐^qq*閞LEK^^4 jrk70 jTdҡ!\:PDrYEծrx=<7 wddTeY o  |Wq `lX ιOS5f"+HK~vF6[@9R۹J-1e~a?oXq=$wrec_h.Bߋۃ2Q?1Et$3hEUnĸjԣ]P'si @c54*">7$]Fw_LòkͺGSz1!f;C4{_3^:n|b*mFU/e'M)΢oL/jBNYEN!ipXD3^6n\&s?wuΙ<%)jgH1,&Ѷ4y>,d/g=O%)@Oo.S !Xk*ւfTvpF2=Y{OmV@O&QX.0Q ,ZU-\ZykϕsVq&lP 9gQ7PÖ eҮ73:zuAu7pfN{nWK=b\5 :Lk='EE<zWר*86;e2reOv].C7^ L 2.MHR/jkzxIZݡ&lS@NNMZrb&|oXfO˹ޥs'7iF;?S p g#ʡpa0uaI=!bz@&o5?dV߾=`*^ LH,"VNPU$ngeݑCXŗ"8>=#c!.:se?[ysgmځD;穢We ok }R1a s W#D$;͌-.3[2K@LocݯK"9t5ݒUR&ms]!:Q/k#j6GJQh6j1кm_vZY%6͎4|Zisy>79j<|< B *=CXn8m|^b Z,|bPLTFuմ DJ3gv(EaT ׁaTHߴsv02xt od 3PvsCoi{yQo[wI %4?юn D~i<J>jAb~"zGx)\WpMWe-GZ&(IN>?|v@;ΕEdIT)~+\+*ZY[~eUD`>ޞ5`b`A! aϜٗj¡'YzQZ'ơ/|{h3 h R HoBv.+aWй;t m}eQV~1IM'8ZMF #Rb[z~H:He0[oibq1aBgk +3r~(bY Ͷnc-w5|OjXQYk{K'@f&|#"&dڛYl(5V/5Kp3چ_ɐ΅ Yk})y cSj. {,P݊e->rlV5aԝo؁WeP^L^<ҟǁ"_hﾁ-,&~^Bz\116G0a>-zF35rVbG#z ߝjvRW?Hw@!O`!ti mvW9b çC rS>n y LnPyP᩶lLȎ^3{gV&bi B$sq"%Jj; r,JŌۮ9Vt aNp3[6!B<2*5fA_:ȗQN>- )|w1vqS #PJ_dre*=/WG{b`- _; Ւp<^ @hI2uBem ?c3͑xykݟCBpf.1g=x|RA5}bdw;{ 7s caxZ4vu$E)'0r.wȽ'emU$23QzHnh 1^An64{C[1 ƙdQHd}P`B"@¯|15[\⡍_v[M5bKr 0ҹOfgP;h[MK",}OHPg#gA y7 R˶iSZ42R- $A[6t>#Y#Whl&hzn7FKs:6W~2$s/6ؾieOJODW28ۂ ,/TyϨ舔v58Ɗ&hOiȗk&M'~C.0ʇUFucNgbg_S㗿<ɪ[cEhir]`aRߕꄴ(ۗ&q||_7Չby\"mAn'P>D)2p½+q-Xe.,L<)Oe$rk`Ck[^[5ȵy;jjiR;i{MH=%U77,S wK|/F:JVLs2F)>whrwOSqsg:#=fp_0 >+'ҧ 3!w!vEY$lL9(id3&xoWWsLm6(˻ƔCDvPCz KRo}7c܄0qQ-rj-3e{zўȈT }x"4:\Μ vuGΰFL Qm׀k_Qosrޛ^H@g17ګZAVuZ*TjOu>V\#ƪ6 86S9rr6=hgd\T @^e_,Nrj4{pkq!&!|=έ̀,+~i"h+6Cy# O#_|L]wY{ȚkF;1,@#f_ZEPipΚ78}2ep|*Lsыp~4ht8w5ύ<i'@k}]e͊Ny{uu\}Hd:l5{QA +(Tzmd-cb?{io'ڞ IVHMy4ĈJ+hhq7?`7'JXNyF{.gmu^ w{0^Є HPeL&/a2ڞQ;ߜUH#'vq_zƪP&AN$ܡTf8DO4G'B'Ik'||Ml"쥩sjifl!v 02c&"V<6]?Jjn-LId=[mVFg{(:H6ie$T%8,:7 NIZڱ1g~ $QY^⛧GeyK9,ތ""\y2WRƢHgͤJw(^uOٟ.@@KlV79U 0աT~KیayTz̍⼐ w%?*NNxzb 5w_pX`Q?ʚn>GYZ} .4 f&? Q:D2˜/1KzȈ*ƺYx)nt 8xXg J?sbXk y\ku0 J&.*a,!M K%/CĢڄmB+!B&ٟ!4X 4uM2 8(jPk[7\7lo*i[%z^dv ^.;f3OyQ MbcRxm!gJ 5Zb8ڼ="*3C™s?XWVRkD)AY@zZO(tau06ڧU :&`vJjX zR8ZfiB&Jg)0)7h8ŒIjec\Z-mz2AZNt‹)OrVM t)EΌ! =<*m# J:m,/>k oâ31ZƐRUxȢ_bD;No ڱrl@Yz)Iijs"w+k# 3 ' 6YR+&K1MUIR0rIo<"bv=LKV$  4ޜH>;5˹L 82B%UF-&VCIJeke:ݑ+։Pys u1|2BFkI%D/ d2m6N Ԧ^9;:(+g>UgKq@].NMȓ .S",6CY{Tz e$[X@mR;z4Q=y$Ym~O4R/tO$ޅ8r˳4N68RYm`xE[Ie%<eP9ZB:88CPL{OD#)΢KBDG1@JQ&Hqĕ^(mьc!On0" SkJ^d爥З naqwu0Ժ:=KHZdVe!+ `F[p ~aߴr~8O$B%KW:,д;wcP :<-ė*}VA,ɭ{MU8O<`,{b01mWb 1y6qdR(HAđRvEhIQDbDԿE.?)|X@"[c %ڠ~?hTt7x36yhqMÉWBZdt MLMCMq`HB. s{!YRÎަ/e oя~[ A+a|w].Ez)U1Ŕ|zh} ZpS穕*}cS6AY,񬆐s^R0 =EPn?0^_aw1Nl:U_͍8ҢDVMl?e[%cyQ+È.,WFm]YHnE9 @(*7*K!{{uZ|E΢7<΋@9ruP+s>ޒXKtTجmbZ/El%LqP=yWFE_8vıƈ?䴰`DG6ӴLf>nJxlDkxWIֺ2}r'/\{L4rDT3 TA]:vo{YH* CfL]7Pq + ] ܺFh {3)m\hu-9gOŠaOXlsʔϒAwfj76ρ7@ʂ}ױ0T *l%hAx˻1@6C)TK/ }JO4_\c_m*,B=ڙn}g%,u(JWwYi UXP^E拾ԹCRI RU(ӄx{WLk;gM Eoj*ባDAN𚀄\E%9Ff" -*@'- gJ2۲9(2@Cxϩ-=CΆIj4~W|8ai_9M}A`*Jƍ׊ !Sd, ۙ|Rw&eϛ8O|Pjhrr: f)sR 9arvGm&>/ 6d=qImD9vAB9Wt+\:fYlM|noj_ШDȦ{ ݒ3A,>@g8^7EreaBH}Ң$-q[rUֽD ՛/#P1\/ w<)°L AtOdxLthJl]ӯ9I Ga ;޶tE|zr"Z9nQ EPt50dײщ%BѾȸq[@b-هT +"l&2Dm(TP[卛ۨlAYR,=%\c"5%z"!{նYA3zVUO U-##tNI'@VGX{bE9bb-VxhHW!9g6o8܊$]6j8аJ[j$^!䷒%7}W@ZeRx]n%2l.'qUT'{*uN=_z͘M "Pq <7a&[`<5.-Wn_sJJE1ӢپCBY8r$1[t ~ueDRW(]Lwv,BERℍ5GA'3Y}%||~ir-V?j=.yEVl*$3~?{?u>$x,ut'_(+" USf[ ]ȧtx"|>e JXyؐ,L{\9z27 7V\ x f7hn +dh.c+o +WÓVN2oK#LfžʮdhXD(6o{X_sHQo>4iwjX /a4}^z:ʾ.2F f=Dհz5jV}tPcGSw z5*ĉ;S^~JT [L' ט隱u?\.7Y6|y˜ عK0RXVɣ8;b|aXMk[ej@&L*?HDȎ*;+Z')1B )_XPi`U郝Ț/v(剐gF\oJaBN+ƾI@F|T=mޘ;wdJc[cvq+].RX \`-ۦ DȜ.]0 |_.th,kh/`c5ҞC0A_U] _I}\k>|%q3G1sIgڋC2oI`Ĝw1-0 E7ј^WW''wDyKT7ӹL3s5:aemE} L JĀ(:bC[:lcq%(;GUR6׊4+ta D+$a@ ]o-b"ۉ^E8"Q&Mą1A6;BxڗO+Ù2Z|+Q'MfUkds,%~L$}>*bMG4j1@M N?KQ_$CtÓr+o *H=#o@c#dvhg;qǓ"P%wTrqrxߍoJz=L@R1i`1\_+;]ItF-V5gbG8ЋP;nwa>*[B_AS_A$(6{m+VsRɐvi ~H$hݚSZ<di3 =Hm.|Sh;kfAȢݢ;ReA>)c [PZ{y~#xwx/eR7k50^ʇwbpEV ^ԓ^EJԥt 2=.),W淋 驃$!^V oƗ0.?98!qa4%2.CuXuY_7r,BXh5fP3z2ږdpJL:yǓs- FT(u?W{fk%1> '1Դm0}^eU]rM9=1_h(֥)Xp4]TY &%x+1xoh̘!+z߈w¨JtwJCTaa|)H}z|I @ 6㥒8օ3g>ؼZjj4u5}]نܮ-%Ohŋ]ɹˠr7/'T"Ee9 Kp;4nH`+n{I[bhx`#;%J4/>[6 ξ%P7mrc`Qh ȹ>b$6ZY>V7G嬨گ9{† p7tiBb^@<\ Q" ziږv} 6JnS'bVXd'[4E\D'; *y*/%E[mW5 l]S ĶbWq(8엯b\]-ȲO vq.x",{n׵ŦDw 8]>4|=dw\\Nbٝ __ͨ5zS(FOXi56[.AQ_)|&wLƷ+kG@&"B-Ozc>eԿ<9bkО- pe4]Tf/Eپ4iɀ ,X,E2MdPiHe*tVvSKl*|oDH!8E6|G7 76&،qJI]67h_Ū-QDZ.~ .pi"0_?/XȾ)˲_ :I(aDy\B#qdA@*1U $"@z݈]&xpaQ+ b`|^YV[_0^ \fyL{M䞚D0s72ŻWbB\WBMfṜOIh׭x;^pU97˳w]]A q1E ٬U62V.clڀ,o3N[s1--P)s wW6HG C\(x^w Db*N  O1'τ+IpR+X{b럵4%Ƈ xz %6Ѡ\eGTz;·mbRQՉI\PF/G0ym~56w(Q0ψjyKh\b2RSQXzszKd?8@US2S}7s$\odhB% eAH'V|ԯ~Nb-L|Њz +a 7 n0c ~J ~DF|َ%BgބGpy.A8as6(0k5eW4bH'yV@zMbi/?[0Ț%2B2\J) MҫZ۴ { U q\rİҩ|.;;9@v*xPS׻NX`7Û1Ԝ{ab_ tyIT2"Y- =-8bg^jY#MGvR/We1' ?uQ% <xuU'sW3,C7dY|tIɠZF}};"R#'BPtH.Kg_]_-m!cdBЮ =҇WW K%71S/tm5$?3D#jp) i$Et"~[D/AX[sk|>\ԶEUX۞A=!` M$@5uLCG%އxUЌߔ&UĞ|躃 4)"!\_S.$ܻvΠƚSpꭒ2*%jaJl $::%jQȩ1; ԫX{YRzI-?Mi]jN%΍4r)?ʂ~ť[QHL7$Gn[%^TaGpAܔ87[3V.r*tC)+ޑY~5~ S!J{F {Q JFB*iadݭ0+_cg48y IA$!bL 4xbD7dgG@:"rJ'ynPY_f^ GvuaըvKF-)t5u8vMbՑ5^dol@jwl/; gsƒ !LK ]u3VN[du~H<{8`ED)xI:k%J!FH5S @SƧyrȧu]|]!&tSjZPc#q͍%xN'vd 2W/j,[eZIݝri+_E>16=JW‚qSRږPˎGT GMISIuKKlk `JYuy[՛ku†сo]N&^}9+e{In{lZ4 ûRbʓ`hkQʂ`'kA>ҿ,/T]I[2\$u(|dwr2Q0B$`Y?נA1-ņDa$H01EWD[ rh7<#VU^ܧ5ML@q5!cnjR>!rNN,cMƋ5^{pQlHQO<7meF$݀HScP!^(\>X-M|ӫΒtQng(֌ƁJ3ky.U~9?CtpL(d(K\^]e5Ybݍ}n{:}Pl3VЏWҷeBt<c|="pyh)FB, Qs橳 cܩ'$`~_L' _MÆX812S  ' KphV@]k`bFXyE!_\@q5{G(9\S<Ȗ kykNSΙ~\*^1A$ ~={e7.!bkeF5\31fNGцs`K]NA0bzF> LAISkTJ6B`c7|@XL/F^G%}F.en48FU9)-8Fn_N|#ZzYU.mR:Jalw웄DqGLPXz^DқAQ +tyy9{XiN F*^hKDskHφQ&JMp~u9gIR~kd3ONLtaڑ@*9%ACM-xz>3l#T{:8DY͗+zI=v5mkjɗHCGHM9Wďȷσ6k 5 kq;`>`w(tKdZv70RgKh'"Ip _nKGs/1rqLG$={S[CM52+ ٓ- hRɞv-Ⱥl(U3\^d=Iv|XYb0Kpl[oiOMli@cqٗ>P ~Iնhͺ&)Oȟǃ=$_P{ڑGb !jfpi[zPŐ'1 [q5`>DO;1ՠ$5?elyuw WXc&6%YD-VaaSkD)෿` e½ EəwL:b/OxOEu:j/~8ᅐַEGzf_, ma &n=(Wq:yg@IJ4q&;Ϲ{M>Z )&L{ևS"h+nU+qx[K0&!|( OSNQEODod(RAT6 gX _I6?ZA׵fN$|E$5 XNmcT 5CęA6nR{9' ;(wb>&yvÝ4^N;Fh\ge܈~p_[ >#ՈYBbt %T"O; lh_%XLVWe)8/G6΃EsYBp,5>>2^Rv"^$9>05tE$r/ j n0 FC fDJ[1l}g4a2(Uzuy!nsHeN2luQOŰk-Z9f놁3 INݛQ/ڙKߩ3Xyܓn6k%!3?v5VqE6݋L &c4o* Wϰ2$%n3?9M'U_>moo p 4BW0{f,Ilܥg :)e}?-~ Dv [!ۄל4$Ezθ4IeJ!H KfkE~O0Q,lrSdg ^]97XJMAg"96AeG `}ک- {:Yh-NM˦pȼO>=?AV/ {/`&-U{9K'2.dP 5u ԭ|û9eVP{mg'%}]KiDj̵d,i"0n^oruU@n#Ir4[Sd[um_]ZV{u.>Zzg2QT f?q eƩc?^h)0DZO.~%چ58Z Š3u-ۉ V]\jN9-?q5S;QJsa]8}#9A`(*O}{KVi2F {bkC뙕?y3è͏Wi0۸$)(V~es~Ll]Jg4kw{[zw3XC#& {2}&kb+>>1ФupaX_=@ù$&Rȍ$k6R)x.#"t/|dpA} =5cy۶Xj8_ "vzDq-qu,׻`<1vyJ@tuIP#գ>J`cr NL׺6o.pr` uMd짆m[炝vĢrIU7Av-DR[u(uRU.;őPoP-z6 0.Ԍ%z'ܖ sL"8?k4} |8AϨ.6'=f Rd50&O?1>3Z}G&p/vJpqk>S7'IADd2k%0FP^G'98]XX*ˠC`vYHI]s+.cC:FH'ѐ5xծ94dgx@o@( ckMOCV´:s18+9s:62 \p66gO_b#0YHfe#k) _VL޲@UHնJ"hwڹD ZrkjI!}]'V"X7З70: ٓ_!YS{#c26ֱ_`s]|k3z 58R)4WL9P`XYzD +9:CfMz~g*~i 8FC?S`&uH?8e’@'B")aĝˈ/rĉBRLR G2N]i" V ,myɽǡ2[{NMk< %H(XxRԊ%WOsuԑv!۱TqH!{F85QVzny"EPMD&:В}{M]÷!_ƖͭI1MY$O8z&"~{ +  AgU7F^UAy9?}n w)?o~aWa8="]7SS" [ Z!E2s T_%as2U{6m,|sa"P$ۨUTDDV/)'.. L]yoՉ6kAqVI0&Dp"Rxfj mOFȨ`_}54& ET6FTgİfu ?R+HyʸT)1gK=)3 4;,&9 wtW-K}RSZ20N"[V`^[!*اO듰qΎүf(Z!;JJ}ߝ eH'd8V` џ51늇JF:8.,]\ :C&}Y)TH5no",OVIMl]j+3Sfڋ1hTAEڔ IYו$ڰ9[S]$=_|| 1&&BZd[G&LmfV_ ѽYݰ@M{ANs2!#y̏  Dʇ荒0̜2^y7yAvM^klcYz4)EQǣ`#OVRcnYMe,$XRY&]~v{Bc*dJW$_i;8mecz`h^Rk^J5@Ӂ?b FYTfIk/qsQbWnQs*٬+?4^I\#(\F0dv9;q雕49mG*02Ch[2I2iseŻfvF?O5.WRxiLڕ`ߥ-bܭ-%X~[/ \ CFͰQךdb͔eHa PN/sYs}qfJAN@?-0^P]|ĒധX2 y=i)v2 &ۄqh-ߍ#B=FD5e0w|ƢX2H 8ӊm.c[E57巬irE{O8=b{fϐj_in݋MMP )I6wL9BI @eczߑL3[`e';m>fK,^kwG@gf]|Svx)L lʹJ,C"ݾ?=X-xY&50⏙GN2Ѿ ,AKv[ӿAcg|;Qj, lLB`\Oƞ0(KPSs;ވ]Iʫ-lL s6u ʩ4|hWae1d62Oo#pf3*fZ=f6G.Ӽb󨺈vjXP4~\Xxm${?*aB zX¨=DA$ɏZUgz:m~ v78U*t !=P!ofdUG_rq"ϓYe&x+`1d4(ޱ *$яDŽ[LE1c#Eoc/D,W:XY=x`KÑ|]8AT)kǒx4jꭂ5~VYb\(%l̳,›wHZiSNe'rшy[TCB}g>+hanU9 K4?HF#' 8^Lx$kX9NSG=Rd>ǜ_% KR ś emSWyX'qXR{T /y2oE[eӭP'l7rf`_kFe)a !5Q0x`_2\yßun"]S]U/ C%HP' a,VM"WbsY}5-euq՛%* V l'ęۖގ,W(E=`ľVzNXmn/ ۉ"П c pi۰mIhojO;zkFM%0@E$n$IGS5\a8̇YsF%jy R =]*=8 00cz j(Ĝtf )69q[{!o,VLn;q9XP=M`0V+~z݈ln,h1@ .g0CB#kA_5Bd -0ٓUgη3G8{oZ iu! EnƸ:g3O!2؃q$Č<l ]`..eɴ}yµ\=>VZaN<0=kLvo3=n(98)30 }CYѽ*q궽eݜVE8]+aZB /YZv@8i`Itgppjf@+ˮU~, XSb kuD`K ]@~xr@S>NjB-2)qq!kuޝ&Q -+ݓmd>uDkeq]zt3hwyovL D( ŵ9. dz!=Vtw+ l[[zSiꈱw~鷉J)$:C^ɣ{5/ .X;B!)4!èZb?ڕh*ς6 YZν.: &d O$AKw/21XUf(,rX2>^MIa;1M=j$N_!~VCJ_}@jو=5\"I'Kxn^ z A@%s'. xT&{2Tk&JR 0O:$Ĝ $sH8.9n- K) 0ǜߪU$2\yCYYCCV9{\WoMu !1:V e̹TZ`Vv.)ϛpRQP I;eYu@qV(\KKGIȲ,WAEPx!rHW:hڋjq6pFc͙nAWZsko"]%T#$ftt~ tr%)-.oSƑil?31QT\aOImX$xA LI|u8^-n07v "т_$)ˆvHxJcbl}vB=jPz\E"hVDH!+G~=H.YWL4fȃZi"W A@'Fa4)ɽ2Talno{ c  aŐo]Wx+[{pQ /Daɤ(ڻ@b[gX39_2Cyyy{a#8D~\`htB1NX*:8yAa6 wvشS߄1 NpkTԖAO<*O=KS6퉛8g„ }'凖*Lu&?/,,x;8Ȍd^5]2O*/5*E\aqڛsy8i }!~|_ސwJHTH 4(ɚ_.K~ lDg'_>1k`H ę>}т gM& HjTt@49g6{+~݃ ) X]Ԍ'd%ĭ|bzC (d굛ǃhJEhЄ*&U1+P~4N h՟3u62a=~K;hy{|XJH0ߢl)>J.M.~B<Gpzj퀗;"R`@u|G _* 3+a>(><U KW79Yi-,q\&Ư=8P<>PN7eY9԰9FpNaZ+hdx [=&z$&9>PsZ( pO tR\k`يY䄬%iƁp\ᕋzݔ 5',t#b%O"kyP&J( C1F1#l% R<6V9 N PkЛG5m]!-0PpM0nK{W>.rnb3rg$=ڇY0NSh0K--mbZ\9i{j˜,V'=$i=!Q9hHofD70>q8F܁|o ;Q"˚ P=#(NE*|>5!UFEkӥTϕ"UJ wgyޅSX̗T~iS,P^\e 7&ƣg|/p}\]\zcD|ݑ1?kۇ `rDL)32G &Jz#fۗgJt c 驝qy~l9G*ȳn3uSA?mު.IGՂ.hת?5{]uj;4Y"}uJm BxuKuz R4SA.Ͽ3 8qBD~{5%1=Mo5z@b=uꚷڼ8AXE%q^w%}ղ|jIY8:LE&7rP=T^N锭~|S)v↉L;ebFV09(nU+$ Cu I(tZA&Tu\|][~Vv(G^o )] qS1Eyi WOR+ x9C&`WJr8l,[ iЦ1!|rv"S Xb-ƕ7 aQ>aT6&?1JjHBnzTBr0('! TJT&,E׆l'hTɚpM8H+QfCm}Y F-|M|3 8"y.""wƉ:{(]yv ˭ļb Mft.#2b -?:%&{VZ\j,V}`oAcaiy<GRbV HTԎ JzYM 'QK ܼ46x: = 5p0t/ e8QZDӱ edr+ؠB%#ikLKeB9&TZ{8>1,l3D;*X nLfew PR2Ë.2dSDűLJiRUr?I2wg /pf.t1 #JD^9m\JLΚI?aͻ7AD0akSl1 RVicBًeL8B^B˞Wssߍ]V+#Z "ի#D'mLH8rkp?$Ϧj` &7 Bm/9/[>Gӛ<&EԶtie]@NMx'2C 9 4LD~l`AV/POtF/jBӞNZkV%iLX:9ʟSK8 gy۷%dMvklزl*l ו;[G?Ѩ{Y fqBEk|i{q[MaV{j195(oL4#*4ߍFt((sKjh6鯨m5pwTɑØKm?WNH'?Gce$B*W 3 R4v*13S!ܪ,/#" S8nLmg嶿E" ?XfO)[;Dͦ=ZO#pL7w)QCTqIdFq)6V_3l}Kdyϯ^fJ5TGJF{pɕ_mPF=?,o+LA,@ Au%7iYmBV/c=+_͝"mn>.=vC "\[7l`냞VPheFLvtr:DnG%fBe&\F0̙qzzB(>1<giuh$A^66ED5U&WC/H‘,"h×J҈\JԨk@j{,Fdoxjм![߹J7)%~]Bw*M}T,wn1Kl_ƙ4n Li?Hw { `Ն<[5}ŲWGm njM(nZ(30kۦRl}Y:0r#@:I*X*M.ԞmYt39N~EHfIMsFM|P `F>?grnwH5j5N:Ic% )HOٙ- [&8TNKu[ xy1y,H Ҷ)ϩ|r4 v7|dL,NOL\󎴧Hds byz (%dvB!Gj"w\^s?1v2o(Tqob'^4v=``NmJ̍{%tSjMyr ۶ΓC:]> >/iӧ/&&e_aV{$Qjc51ɢ:?z:OQ:(;U2CS9#~Kc &[ۙ)EiD21V-Ib.HMS3Y(_eB(E[pD/bx{]Ӄ,, b/ dz9{VYb%Or[$'Bc35PBr%ٝfbO{ G蟾+[?|40%aq5,|qqXIoelc NZnPv{K%A c\R o4ZtћHk>=znAG$(#Ձ r2 m={RD R gb8}V}sXG "'b_)9.?gkDT>I4u;,il>rNX]8jA^&ه, 4xˠխv1;z֝*Ju!) s3{%bPx6*ewWk|A5YDv(E]+=B 5FznfkH3T7njn Ve@CʑEi薺 ~)-fdkѮ/5Й1uC&v˔́e[+Gc_qA`S`!%ͅ8YezCuɦuJjew5S PӅvWU58g[SpJqx6Wb9l{SȐbmj\ }Hu5LL|7iC 䏫"K 04aAO͚@9EzXc"Qt" DDkneP8,͓C>0*aڍeiKtKhP"4u>hN$̄倰{-)PK xkllf=KL[Z)WY?&W3ka m3_M=%pw|vZQ֥]-aGcIxlxq[ڝtbJXQ5Fx>cR唄4Hee- ]9^vr _pGꝋY/rf=kԙSƸ)+;%]9 "W 5͐'8IUA"^߆HկlLjWUk m-%bt>kL3 oяjkwux~dNT|L5C`>J$ed9Eߺ@&H17`veK^t$羀RRKe: olܧ:[R"dLbj7uW{ԇ!r@aXpxO+,W:S6NYq Up5s}N8ta]Fs3nBShՇ)ÜjGE7ck BL,Cnւk86 kx$ cVCZ3_ά-f,̕aYi՗ҫך{>r^r$s>+^l/=$@k9>ؠmO1,ɚB).tm_׾1g{|bu98W4dxyݪՇ9wxV%0OajEt,QiPM4U˚c˯qspOnt"ICzwKޗ&_K^|} (MN[rwQRS@^#x3/f ZSxޒ9Qjq0b2JqBg"aʛ/Rt-m+R4ex^n gB&(oj7 F=GgSJ]ĉMm !} ZRj|݉+,b-2!$8#"T!@nժwi'Æ" z{$z{T`}[OB[ixR"GIaO`M6GT.vr$. n~ 2s ?>vn;naoKyLPYRQ|@@%|f$[}gQ9?@p` RjTXoIeuV&4d:tDnj 7܆jB!I/j#CX%D>&K qHdIf(N̮Q5Nb:'(f`DC3QǑ(Lvp] ?!oEA;ȴAER曖S 5A08h I@#匝H˾2_G= =/E29z+#FKCX@Z$^7%m#NW$mҩ J-z8 -6XNv{Ѵlo(dڟFTW+e:֢Jki!piZ3 |HC{#.x58 maF uySJ ҵ2dw STCGc)23 L ozH4 I~jmYdgsjO];~ZmN_ٶvTc}-k8¹ˋ8ڡ]UWLSR.^*rcKEkZJ Ө5ЛCh>/K #"X64R#ˈ !;3#Hˋ!ekt{-hu\Zu=q <(pdGrC߁sk:N}X}TrS3^:8GRy' %sQTѰ}`LcrgH @xT KKAF4pmJFi&pzECB*Fcre' \s#iv4yqK3T/wѹXG)+~bgŮ2*vH5gZMxX nwUO΄j70.]0+NCCRӏr'J(De"ډ9MAYRo59'}9wDf+"e٫UǺNɽޏ|Jtx~e}vJ6&(3yk1f2 g`K$`d0YNf'EkzM`puV׺&%")(FuVJ1F-h|S*~\wgv!vvĐj X[V,c|O(^A?~Zg7G1THq 0[1mވT3wYpffǼ[8A_Y;mr27FA4)AK['[R-z c'ya&E#ͳc(BS]'_;4 &AA d}%[<:U B%j<&&_D Wz>β\eYԻ &dT8p͠UvW rbXj-tǡQ΃̰K*0 frBſXE,ŚK5DggX/ {HkA'-3?} JsTRiF͸.hlƸdTp.HdiYJRCn vh tď=_1€M9Iq1|enf#?orW:2;]^KY1V-= '$w5qϨlN/>)2^z^i*$&o}]ek *c.5IN ٌV z ~ ON:C#NgJkߺsd62Vu4]9uƒfkkuk('ygE Y~ ;y_-w/6uxLө=I44ﰒ0וh'Gз5yZX'Ki'*H/҈OCS^Uݖ=;KxfC#) $xKE%(-U]y^4ͩ~2:bӰMVNep ZaxqV_9AEmE7&^V۱e $%_Re~A;Oz2 ݹV= 0=xaPr|DԅHgۚ:/:((7txiaQ\O@_7noWw6:%7aQ:}sϲX9~(ف'[go! ZƮ h_{ n>pS >+UA3SoҔ' #Q4-݈G ).EPu3|"o&!([WvO*wwfsV*i}PkW86L0vnCzAjQ[^W,ŸߪfiؘNw%V| y[pLz6ѓrnmgSfy̤q%mlLԐZڹ-豃r.X `r'B~_?GS:d1dܶ蓺|ѓI*| 7gb`SybbO=FhJ~+Orù&y^Vf39,%)9|fEKKq3ƛBi~фZ'!&pat3JjC9K0b EUN_w o#% a 񡙣}*j#F=یmvg:McKԑ~NL B},$h)M'@MpJg&0Ay2kDB:vJg^]\`ֵE[`NiC[1H1ɠGMBmBo[of63*Й$c5b)%/:{B~4[`%hW?Y?^b?”e̍ `RĻ`IM[F@Tw"?IPBkͪ#O].7:pݗ|GTVP>-<5?pvB;.Pwf(Xm* tމ|ijH,eDӺne+O;^D#dn"㿾<0(7}ˏp(2탨N ,dR)bG)sUE/T=(]5Y gCʁ+.ȏ Fl"^tnf6]8Q?(2qVP Lz+I2MctۓPOW=2g2z=wkyU 8ށ Ch~h<@ YߡiFjpy+cTp5Ţ1Oȱb mͨBHkTnL|4SIզS~9hx-3gZNiCM@}'w7fƗBW  *׶~Q U]޻ Zv^c CD#Pϛő5bwN1,53}go.o[npx'N|pK^+=Q$}52uW_-ge]5QzV$ 2y]2F2ڪL!!jYfL]OrsrˑHs:$6#~eaP e/ojͷd|k<&(]@,TӉ:h9Dؙ-  ,r+LbZ:(3_c_R} :GS(IM3CS oxMXԀ%a.#sc ߻YXe/ٺH8% |.-L}$8JL{΂[O̗WťۗE+ r}vD _3`j"[oWlY%tU%4_/{"5xoAf"4p81Ñ:WBLO˯!#57B15 l!`deohBp1PgP*3$i#|hYjz4=8ޑMDHVXhh;Aοnh\^%,p+C3D |vԊ:eTfA6OCae|B{; & `zH@7TM. jYX-_r:LS"ۆn&H'o ^'M~ _q뽺@c޴i.*"ar*mTշ/NL4($$r<ی2X,hbVPZirP*k)"pL_ +eEV6t^ꗤ!aFŋ- [-p9# !ȫQ*_5R睒B_Pa#^dʭN/J/vE?(7J4 sP5k1Apgus33eػoXlr?XJM|̒!ugnw: :}$NU6B>VifltG{V""uIv <cnS0XPvQ`&ӡ1%7??Q%$?]rv%LXXsr#|}.ySx]z xkU{xװn{~ŏuIdÛr]s*>s#4RҎNˬtj^2R-a{76Qy>#)t\j&XK$i8uCg.p#g3kArp,o7ue=<:w&v~c{#]+;M}{H Lv Ȝ؏)mW8l 2D3izDNeÝroRGlMEj'o(oRO \Ty<5m}L[X,̵, CMq]K>tG|͟ gEYh'J_;iz~ RІ$>Ypώ TTF@d":\Gb|;!r4u"4Ր΄pCDք@W]e4`w!UB@$4=`v+h. D+n' 6*z[+Ok:LkF:cW| u-9:i&T$]BWWd4jLUԁ%4$a ϥxg K]]{ȩ30' ൨βaHJi>+&qtre(qq V١{\ʒe\zv l0]\*8&w=ozIuA{u R|% |mQث8:5<ꮩ$w,::\$lzY^ <5u-FO> NpMe'ZoYA[&%RHDMzmyLBjR M? sҎU}@ںmdo_S 8˕BO' lV>^^JWd,ȿu03uz"Tӷ<T~K[uAfM"9V0F0-69 ]'%wá7:^B1h%hR VݵdZm"kn2즜:e"m b=2. ޒiZeZlq"/dsb[LT][Qgh^þ}A@ kFMhڋgDCa\!z*!?9+K췺Ŷ:qT)NZ`x0WIf,8S[fw?,tq$uR9ҊӬo՚;?`.]BޟVGKx=O$%n_BN#vp7u6<`{ CΞ O@ZfxT_so^n+~uo bOb>F.yj0=CD=nMaj@;w}Xۡ@$I?OrGʮg>zۭFTnb:: i3_=%W<-T20[ߦϸ n6se2M+0ŧK^W! ~ҟDSt}`)EU+9(E2㛢N10JS=ma~̖+Aj$f*k$aS>xy'3$6jpD`ta/]샎RQA =,seX6ðb|Vf\}[Qe%ǖ˭wUfnY[w~^(΅0/bLYx/NލnKwu<_@La>Wz.a; Fp Q?}ؑUU:aX[u弝rC; JAJ} ])9>'cУ> +9p2$!Fp}7{U㖓P)H68JY(f_b#;&;w/Y)AT.JTISaB8)vFIi?3NltbFP;A_Ǎnh}c/2Inm7qk c\᳝NL'!b4b_~ SL6&rCQOe/:LjުHEjMѩZ,Cg%0B7Tպez> ),fϮs)-WX@ ݪ\!X 7Cog ټSm??1Wl?\fBLz.պoH:X,E4K '/mvc M@ +wEI"5Wm*hFg;2/{i2.ur)|ҕV"P "h+;_>.ߊ3Rǘ\?~C 5bY.@zMY| WrP#( r8.9# _4"gVy1E%B]W12"j2JzI}5AyƛU6- Zn;*.ؑ'bƚ `"3G493?Lޒk!BAF@@QS&1 g"&AcISCL S>@J0 ZV5װX.51W^7Ưw%I5:hʲsl< mWU*QκۃJS/6ɏh5^x\`~ҁFxA%ѳ͗(L&0.exIKPqo` hdkP*/|\C*k5FaJ-{P}a,)^iqrqLs{3QuXI}ƱN/u&&*wI S>,-mE*x*gvhi7 y\^md%\tfv@oJ?WTkH(m*\c/o6zg`](jAC- hmfN|Ŭ ^Km3HF^ex Ά ;(SM+71c7wMjc>lK="SWho.Y\!9EѠvf_pB AΞLP3=[#Z!B E–mw#H PE>l";ֻ4-c0leqDE-DqtdjGhU+!b ,I O χ|}5A+p9yR GønJW<;b_Dנm{ܧZ=/dz\}$}?jZN!F!Կ~e+[7#BdSgGQc!%Fe/+u%]g .,J &spC,pd{C ?j:.$UZ!hf-8_k*[I4 HV>WYAXhŒR+'|ωhi ~ѬΑPM|i¡6?a4U z^FPL47&RILpØH{gO3Wӭ+2/ 1`,-ST[*VE!d&b|@ w䯐}FH{B/"6C!cT/Tؙ)͠jZN&k*S,΁6r:tb.XzBIc:ߛފH%Z/vJ=Zޓ5^",{QFi+Fŀ-Tf.bQfLƼQ #cN}l} {_ 1'jUpR,nSwV% ЙJ25}Af0a5,| .jG+Qi=φ`<+}嬂˴La;fhXoKyqmj*h<7S9o,DMoL,wYKH8 co&؟p|Yq䝘}dM_Xw-28%QXH3X mdpo~,-X'o/{J"+ɡC;9zdc,I5sf8@Z<A[#`@ ي{4BJ Dpi xqv5T]w[fepr|Eysz :/˷2fYiZQܳXj rzVVjvi!(w/[Z{3;:1 uJSI`~$v .L.;#A{JpipdMg&z>O,9V5-m&Lp5&DkX ?V`ΧA> +I='37CI=)Ɇn1_ߏ3\o/g{LF#iuTթ2`? tmzĽfJ۠5~dO:THq,,>} hZ!hƃERtI4fFMs̒Sq|hɄQP2X m!{)Xd [lb7p jFPtHwUt79 A.I0R;zܵv:04`eQ< 7g JC)EQNL{CE5v;I|Oy~w\wƕ.KV #Wq_*PIo{sO?iSzFX}E^ƌi8 #ٕYEkSг!PRuI.BKSFC! dmW`y2.!2XCeiڅsbؿ!f}˟+picHQ#! }IJNӂVBBs^bԱ`Ƌ/J &]\}"`g`@xC="I⮾nP|F=/ΪU+r%(z}`JQQ.̺r/56/M@hwX{Gjؘ 9g6?d]MC\;g$*#Q%g&V]zeB9Z<GF hN֟rMe*'1aeiy`a?V6AJQ˥XiB{HڪwPgʌ]b¿"F#.U! ꑟjQ B7.lKq=] +(i& )%$K4['ܩ ]Oc;'}T@rX?"G&Ӳjc-9݁pd4 6{,Dcc)I%4Wy=v!])0ξaB܎$5xye7q# AI-],ӅN3Jrcz,&qՎ#68LٲxfUh]eR.a z?R>Nm:\cغjx"V}n]6u`հ s,/1ɾ E]ʱ;Lɯ^ʰB\޵;Ck8LՇwO78fxxFZ "?ͮĝju֬xPکģJfüZ1,9ob\/_ciZtS ҐWnD7aa3ɊQ9r79N {OTy 𭲓*#:Ͳd )T S$5 YrfNI *OFt>u)8êX~Ӊ X?"}ԷfK˰ Ԫ gow˛ yw7k9-f'CMeKD4dv'TBsi-VG;)'Q$цqY аzTiPWⲇe+ \Z*^sO%A.A-u#2tX+D=3"}vN(  x7J`,m.|n;[eϼ#LK]o(!AF1FHFNRW"9d~vnwH&Y GKtC\>UMJ]$=XqM5{/XLL߁,W~5?ԂY#ߣ|i8~9H}%V(}3 py$.J/[1/B4R*)w}t|-g' p-t'*y^Z4TPvwKjb_C cC Xom_ :$`";erAsrT҅lUG#*Cem!ۆs/.VKSo-#w(R060 "T?K㍮E !+Z?XJgf|87S$͑RO7jnY bu~ewT(% uo顙ZjX0^`#$8n'13!vy6Ji'А Y2FAdU3XzI[~d_}/YAWI|X`;n۞'tfQ589#0=\5LijLj3_H"+$զk+)B.Cbiۜg`M&U{\츜[=5QJu_R92?*nO  E=In{rg$?ap@KXq0x-F!m  ,̬D>=<(Zi:7_7>@95S#N_"$[Ba~ApFq3AQR$Wd<ϕa5b1fH-@Fmv"\F/$olYBӰDJ"k j`$IHTr/tHhol,aQfv;  HTG:C>ao"*~9٭' X?&24rnLgR n. K쐶HgieF3+f.HжGEk˽[\ y R73wVO7+ӡH[]ᅵF>؝է<Ry_qX?*?6nz`4aYQ1pUz=.2˔Iv43N5kwEn|C G>r/E~] va'C! @owWՃ cHI!YJb:0R߇G P:OVXMn+iU35aÏ *2rͅs>8pAq?Ql,4QZ "-RO)$)~m"w0 ;z+P{|_CC éE/2Յ ڸIqS2a4NgbxvxޗX1GMnFԭ O))Ŝ8ԬJ*4I -Bn zYvy)0k*qޏՋE'\χ[.ב j9=4P!pSrism;'3A4:v/V(;X萂#^d'bZqՍL+f3mD>ĿpKy"Vttyo>Y5R-p3`39+=ng*FuL]onTRY YR31=!ppt3%x.yX_u@Q;,P&M=[[.> | " )gu7D_42^xԆ9K该:e 뼛u\\eA&6 ǪI$c ߿alpe$B3&XĘяz]+éxՎ*|\5C=Qs3WzszybE!U4BӰ{NPsmxYȻNVH]P 4wePep$ %,yx_ sV҆[}*fͧ%BCT"dOu55x{oDF;Gɓn*Y09nrl-l9Ƙn&hVmٝMwQ"61ީH<Rlpi/9_Xh](= WmAdHep' zb}>SkІ1r]񳋜&.pϿ2!l=?5/f>Kt+ րt {'"hɌ.ETGI4gG&+0-;6$㨇UC؜s}%(x)sR*}⋋읊l{p#԰] T$KtAoV#h#L>4+H iwSW/Y<`-pֲ֟똧e=TE0լ'E&5/[NpִkHRDo0'Lgc#=u;e1=9!g x!rVz6'.]or6,`]{:@'׬9.,dj:nA9k{fpfuf&c3 %OKnU^FM  zű}@UV1VGklJWkڬeFIot~^‘_ +2j1H)WVȉ?0s7y܆LpY"OĻ0 9)%aP׿օ`!vJ| ar)1\`{n:ƿS1Xp%H;gAe"zY(w0mfy |Rj=yuD csH32Dl5XHSMzM-_jud_;R˿eڣ}"2_}^¹c #&dNuKuU q:厚9튿%-Q:iĠD{1Hd8 j)L8` l6K+̮Jnx p JH_!TS 'ݟ^=%iYv!h5Ξ̬p` r`a!0~,cӐG_Wud;J"*$Bi Lɑn16L(Dϰi`v,}>gJDap'?,4\^F~nU{>M=~/Z1usrAA -[ K֟Z@.T$Ơ 13T;ecyjK?[HT]|m2[9 2|oq=( =}m_\ɩHM)|!q+.^wCMW 3Ǭ4!$k$pdQҀXVXlPNցnKJe7j\5uIΥs]NUOeQRu ~bF6Hf [0 oc"엀~_=KpߚbqxK0oDVE&9T-Bm' ( ੜ7bc@ v)ӟ hӣVH(dtz)S 2GNG7(~ɓĺ ;-uu?&1sAqORG9kǂڠ(mjy&:Qa#$ GmT#Tý.5. E*K7{dG즯 9y/db}62.^0[qp ӭkX苭irV6֟5BVj;@}7 B(wjP>D4?ce!=Do-رe=#` ɕH4m,u*bmpm^/M#x6'$@ Ux`ĔD) gMnNL>k* ; Le. }"q&>~Lp++JM&bCY)lNmJziLSsHm&ܯ:wei J:}M5DZ1&%7Y4)`$g#'vLŽճKn!w3),6ႏAXOFxvWc9*4F*N嚙WQrU6%~ɼPqit ]aJ.}aB𘠞i/-'Jy!P0DD#a]lh9n!'!<@;o{Վ^<,4(UA`=kTC )~Gjy/ (>(_I~[ d zR/LTE| g"0}]E#'28E-jbK}X=򒹴Bvg|E^0<",`C"%xF`]q?# Kž!/.£2{x+N2W>)'ʘ7ѽ -wkeDU<2iMA I_ֽV5wY,q RՂ뢱)tȦxtgx[x\F\AҌC&'$N}Nup :Q(v%לMCVuX -bM$d 򘈙F$SVoSG '; :qMF'J~ j#YeYYJYAI[c0 L 1pO 3ʜw#e&})artX<&-AEi!Vuk9VNGc a>OR_b!i9G9&t$"%' Iڜ&y=GYs*q;ɣY-xFǞ~laAt/^ > w4eYYɫemų8pӹi 8RRn f1/"z(-Ħ(T>լ :m/qV $zm")q݂I4~`0af ~9/NUR6ɦ[׺%b'`˧X2;h. Hι !~&Ty,ݬ9n ᤨ=@ bÁ)1n MA&bWtÌV cE!\Hm*v稲Ep#߄O4jɌ9}l+X3`*h"d@9`^1" QX%~A3(߹ j:)-#'ogS6I[,Z̦l(^,lC8O>ic/fk`A0R65}R:Y%ߩLPP!st˕f!Fzzb}I(Z~&ͯ'C_FxBA~1=)?]p@ t[J(ʱ9$ cֱTOvLClwbF|Dfy20k{zU YkJv!QmX_4>_.pϲ>]Sr}T {dZNE$Az32/<ǐ<: gU:)Q鬶s)͛H@UX?IO#8{([ߟ{;֠<=)i T? $uV@qJ<qr$~2f#mGtNQ5Gz B[A=BH؃cbs!}V5B캂v8ZwJ ֠Ip(m={0'V^Bĝ+Јc \NV>iG]!1*}ؐd99/qC*Kt^Q `AJU' ty4i|%bWsC cKeU՗T'"!E{/۵Nrt_O1c[Z}IRj T}@̟(/5q L_u[@U%=nrLhd@Z#ԢzrcJw\l-!˫g+-l] ^=( ]FN<;Ȫ?. 0R!32}[̂x戴T Fm$'S|]Հ]b&uGܐ] +81IFS6'+9Cy1v.5?й_{)7%a/&De3Ad7=1juuE WBEJnCӠ>\o_v)(U+ (`SȔ; |d]>tlL:)YfZ+*f*`o(bȶu3w}K*E|ld$6FDxuezBŒbGbY*2- A&.q䋗08g4r֢1mXG7zw4B_6 9c jqw%aeۃg~zK)U:谢G.&?8qxBАU`@"08Ǽl>qCu?;DjPF@ MEgk