ktexteditor-devel-5.90.0-bp154.1.38 >  A b|^Ԝ!M@eee$6T])yjWz;]i"8ay?Nj.]]Ba !zRײV:{z8h"p>?|d & h $48U^p MM M 0M dM 1M MMIMM$h8(f8pg9 g:+gFFG`MHMIMXY$\PM] M^ bcpdefluMv0wMxMyz,06xCktexteditor-devel5.90.0bp154.1.38Header files for ktexteditor, an embeddable text editor componentKTextEditor provides a text editor component that can be embedded in applications, either as a KPart or using the KF5::TextEditor library. This subpackage provides the header files.b|^obs-power9-13Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Antonio Larrosa Christophe Giboudeaux Christophe Giboudeaux Christophe Giboudeaux Wolfgang Bauer lbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgalarrosa@suse.comlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgLuca Beltrame lbeltrame@kde.orgJan Engelhardt lbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgwbauer@tmo.atlbeltrame@kde.orglbeltrame@kde.orglbeltrame@kde.orgchristophe@krop.frlbeltrame@kde.orglbeltrame@kde.orgfabian@ritter-vogt.delbeltrame@kde.orgfabian@ritter-vogt.defabian@ritter-vogt.delbeltrame@kde.orghrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.comhrvoje.senjan@gmail.com- Update to 5.90.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.90.0 - Changes since 5.89.0: * Add a formatting commit to ignore-list * try to fix behavior for vimode on completion (kde#444883) * Change build system to make building against qt6 * Apply word filter on async completion models (kde#444883) * Validates the input method attributes received from input method. (kde#443977) * fix compile on Mac if EditorConfig is found * Remove unused exporting of SwapFile class symbols * Fix cursor position after completion tail restore * let cmake generate the PCH header completely * Introduce PCH support * Color current indentation line differently * Fix unused capture warning * Vimode-keyparser: Make some functions more efficient * Use KTextEditor::Range by value - Rebase 0001-Disable-KAuth-integration.patch- Update to 5.89.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.89.0 - Changes since 5.88.0: * Bring back git via QProcess * When reloading, don't override auto-detected hl mode if not set by user * If user didn't set them, don't override file type and highlighting modes detection * Pass KTextEditor::Cursor by value everywhere * Use const QString * Revert "completion: invoke always" * Remove selected text if preedit is not empty. * Disable "tail-available-on-undo" in ViInputMode * Fix vi-mode completion unit-tests * Improve built-in search performance * Remove duplicated lua.js indent file * Fix a compiler warning * Review KateTextLine usages * Create a separate path for fetching lineLength * Use iterators for iterating over blocks * Completion in two edits feature describing comment * Re-add "undo removed tail" on completion- Strip 'Source' URL for faster submissions- Update to 5.88.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.88.0 - Too many changes since 5.87.0, only listing bugfixes: * Expand katepart metadata (kde#444714) * TextFolding::importFoldingRanges: get rid of UB (kde#444726)- Update to 5.87.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.87.0 - Changes since 5.86.0: * Add Gitlab CI configuration * The user is not selecting as soon as we clearSelection * fix missing i18n (kde#442071)- Drop the unneeded baselibs.conf.- Update to 5.86.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.86.0 - Too many changes since 5.85.0, only listing bugfixes: * Python indentation: decrease indent when appropriate keyword is typed (kde#392732) * Do not show encoding error when file only contains BOM (kde#440359)- Update to 5.85.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.85.0 - Changes since 5.84.0: * Remove module prefix of include * Network mounts performance optimizations * KateView: speed up large view jumps * Fix apidox for class Mark * better comments * ensure close button on top for replace * move close button to right for bottom widgets- Update to 5.84.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.84.0 - Too many changes since 5.83.0, only listing bugfixes: * WIP: Take into account wordCompletionRemoveTail in completionRange() default implementation (kde#436170)- Update to 5.83.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.83.0 - Too many changes since 5.82.0, only listing bugfixes: * Limit shortcut context to active view for Reuse Word Above/Below (kde#352902) * Add "Transpose Words" feature (kde#436621) * Fix on-the-fly spell checking with recent Qt (kde#436004) * Revert "Add option to keep spaces to the left of cursor when saving" (kde#433455)- Update to 5.82.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.82.0 - Too many changes since 5.81.0, only listing bugfixes: * Fix dragging when folding stuff is around (kde#435500) * Fix incremental selection-only search (kde#327408) * Attempt fix crash on dragging (kde#435500) * fix memory corruption on 'Close the file, discard..' (kde#433180)- Update to 5.81.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.81.0 - Too many changes since 5.80.0, only listing bugfixes: * Don't warn about unsaved changes when closing if blank and unsaved (kde#391208) * Use QPalette::highlight for the scrollbar minimap slider (kde#434690) * Restrict horizontal range of cursor to avoid unintentionally wrapping. (kde#423253) * Add option to keep spaces to the left of cursor when saving (kde#433455) * fix unit tests => don't remove trailing spaces (kde#434163) * fix spellcheck word detection for non-ASCII (kde#433673) * fix auto-completion for non ASCII words (kde#433672)- Update to 5.80.0 * New feature release * For more details please see: * https://kde.org/announcements/frameworks/5/5.80.0 - Too many changes since 5.79.0, only listing bugfixes: * use correct function to determine with of line number characters (kde#430712) * Add option to preselect nothing when automatic completion is invoked (kde#316413) * Temporarily save unfinished search/replace text (kde#411923) * avoid crash on clearing of bookmarks (kde#433006) * [Vimode] Do not remove empty lines when reformatting (kde#340550)- Update to 5.79.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.79.0 - Too many changes since 5.78.0, only listing bugfixes: * [Vimode] Do not switch view when changing case (~ command) (kde#432056) * Increase maximum indentation width to 200 (kde#432283) * Only show bookmark chars error when in vimode (kde#424172) * Retain replacement text as long as the power search bar is not closed (kde#338111) * Allow "Dynamic Word Wrap Align Indent" to be disabled (kde#430987) * [Vimode]Fix search inside fold ranges (kde#376934) * [Vimode] Fix Macro Completion Replay (kde#334032)- Update to 5.78.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.78.0 - Too many changes since 5.77.0, only listing bugfixes: * Show the dragged text when dragging (kde#398719) * Undo indent in one step (kde#373009)- Update to 5.77.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.77.0 - Changes since 5.76.0: * Port KComboBox to QComboBox * use KSyntaxHighlighting themeForPalette * fix i18n call, missing argument (kde#429096) * minor improvements to theme search * Improve the automatic theme selection- Update to 5.76.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.76.0 - Too many changes to list here.- Update to 5.75.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.75.0 - Too many changes to list here.- Update to 5.74.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.74.0 - Too many changes to list here.- Update to 5.73.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.73.0 - Changes since 5.72.0: * Use KF-standardized Qt logging categories * add icons to all buttons of file modified message (kde#423061) * Revert changes in autotests. It seems that camelcase changes breaks them * Use camelcase include. (scripted) * Use the canonical docs.kde.org URLs- Update to 5.72.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.72.0 - Changes since 5.71.0: * Make "goto line" work backwards (kde#411165) * fix crash on view deletion if ranges are still alive (kde#422546)- Update to 5.71.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.71.0 - Changes since 5.70.0: * Add .diff to the file-changed-diff to enable mime detection on windows. * scrollbar minimap: performance: delay update for inactive documents * Make text always align with font base line * Port from KRun::runUrl to OpenUrlJob * Fix modified line marker in kate minimap * Port to KIO::statDetails. We only need StatBasic since we only need the permissions- Update to 5.70.1 * Revert "Store and fetch complete view config in and from session config" (kde#421375)- Update to 5.70.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.70.0 - Changes since 5.69.0: * fix drag'n'drop on left side border widget (kde#420048) * Revert premature port to unreleased Qt 5.15 * Store and fetch complete view config in and from session config- Update to 5.69.0 * New feature release * For more details please see: * https://kde.org/announcements/kde-frameworks-5.69.0 - Changes since 5.68.0: * Make it compile against q5.15 (QString:: is deprecated) * Add missing include * fix folding crash for folding of single line folds (kde#417890) * fix unit test * [VIM Mode] Add g g commands (kde#418486) * Add MarkInterfaceV2, to s/QPixmap/QIcon/g for symbols of marks * Draw inlineNotes after drawing word wrap marker- Update to 5.68.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.68.0.php - Changes since 5.67.0: * templates: Convert license statements to SPDX headers * Remove duplicate include * README.md: fix example code & code markup * Fix minor EBN issues (http->https) * Make it compile against last qt5.15 without deprecated method. QOverload::of(&QComboBox::currentIndexChanged) is deprecated * Add an option to dynamic-break inside words * Use ecm_qt_install_logging_categories over manual categories file * KateModeMenuList: don't overlap the scroll bar- Replace %make_jobs with %cmake_build.- Update to 5.67.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.67.0.php - Too many changes since 5.66.0, only listing bugfixes: * fix Drag© function (by using Ctrl Key) (kde#413848)- Update to 5.66.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.66.0.php - Changes since 5.65.0: * Fix warning about unused variable and minor optimization * Add "line-count" property to the ConfigInterface * Avoid unwanted horizontal scrolling (kde#415096) * Port deprecated QSet::toList() method * Update the obsolete projects.kde.org URL- Update to 5.65.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.65.0.php - Changes since 5.64.0: * KateModeManager::updateFileType(): validate modes and reload menu of the status bar * Remove unused include * Remove KIconThemes use * Verify modes of the session config file * LGPLv2+ after ok by Svyatoslav Kuzmich * restore files pre-format * don't touch templates/- Update to 5.64.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.64.0.php - Too many changes since 5.63.0, only listing bugfixes: * fix crash (kde#413474) * add missing s (kde#413158) - Drop 0001-fix-crash-in-variableexpansionhelpers.patch. Merged upstream.- Add 0001-fix-crash-in-variableexpansionhelpers.patch to fix a crash when adding a variable to swap file name (kde#413474)- Update to 5.63.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.63.0.php - Too many changes since 5.62.0, only listing bugfixes: * QRectF instead of QRect solves clipping issues, even thought the rectangle has pure integer coordinates/sizes (kde#390451) * Add keyboard shortcut for switching Input modes to edit menu (kde#400486) * Backup on save: Support time and date string replacements (kde#403583)- Update to 5.62.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.62.0.php - Changes since 5.61.0: * Allow to customize attributes for KSyntaxHighligting themes * More port away from Qt's foreach all loops over method-local containers * Port away from Qt's foreach all loops over rvalue container objects * Port away from Qt's foreach all loops over method-local containers * Fix for all themes: allow turn off attributes in XML highlighting files * play in unit test with better searchText implementation * fix build when using Qt 5.11 * simplify isAcceptableInput + allow all stuff for input methods * simplify typeChars, no need for return code without filtering * Mimic QInputControl::isAcceptableInput() when filtering typed characters (kde#396764) * try to sanitize line endings on paste (kde#410951) * Fix: allow turn off attributes in XML highlighting files * improve word completion to use highlighting to detect word boundaries (kde#360340) * More porting from QRegExp to QRegularExpression * properly check if diff command can be started for swap file diffing (kde#389639) * KTextEditor: Fix left border flicker when switching between documents * Migrate some more QRegExps to QRegularExpression * Add .clangd to .gitignore list * fix vi mode unit test * Allow 0 in line ranges in vim mode. * Use CMake find_dependency instead of find_package in CMake config file template. - Replace foo-devel with cmake(KF5Foo) in build requirements- Update to 5.61.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.61.0.php - Changes since 5.60.0: * Save and load page margins * Don't persist authentication * Re-map default "Switch input mode" shortcut to not confict with konsolepart (kde#409978) * Make keyword completion model return HideListIfAutomaticInvocation by default * Minimap: Do not grab the left-mmouse-button-click on up/down buttons * Fix minor typos * allow up to 1024 hl ranges instead of not higlighting the line at all if that limit is reached * fix folding of lines with end position at column 0 of a line (kde#405197) * move enum to dialog, only used there * Add option to treat some chars also as "auto bracket" only when we have a selection * Add an action to insert a non-indented newline (kde#314395) * Add setting to enable/disable text drag-and-drop (on by default)- Don't lower minimum Qt version anymore, it requires 5.11 now - Drop conditionals for no longer supported distribution versions- Update to 5.60.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.60.0.php - Changes since 5.59.0: * fix goto line centering force center for any external set cursor position call (kde#408418) * Fix bookmark icon display on icon border with low dpi * Fix action "Show Icon Border" to toggle border again * Remove ifdef for Qt 5.11 since we require that version now * Fix compiler warning about unused variable * Fix empty pages in print preview and lines printed twice (kde#348598) * remove no longer used header * fix unit test for all operating systems * fix unit test * fix autoscrolling down speed (kde#408874) * Add default variables for variables interface * Make automatic spellcheck work after reloading a document (kde#408291) * raise default line length limit to 10000 * WIP:Disable highlighting after 512 characters on a line. * KateModeMenuList: move to QListView * Install in new logging directory when we use kf5 5.59.0- Update to 5.59.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.59.0.php - Changes since 5.58.0: * Don't delete entire previous line by backspace in pos 0 (kde#408016) * Use native dialog overwrite check * Review del/backspace * Add action to reset font size * show static word wrap marker always if requested * Ensure highlighted range begin/end marker after unfold * Fix: don't reset Highlight when saving some files (kde#407763) * Auto indentation: Use std::vector instead of QList * Fix: Use default indentation mode for new files * remove duplicated assignment * honor auto-bracket setting for balance check * improve invalid character check on loading (kde#406571) * New menu of syntax highlighting in the status bar * Avoid infinite loop in "Toggle Contained Nodes" action- Update to 5.58.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.58.0.php - Changes since 5.57.0: * Too many changes to list here- Update to 5.57.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.57.0.php - Changes since 5.56.0: * Too many changes to list here- Update to 5.56.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.56.0.php - Changes since 5.55.0: * Remove override keyword * Use isEmpty here * Remove deprecated method * try to improve painting height for text lines - bug 403868 avoid to cut _ and other parts still broken: double height things like mixed english/arab, see bug 404713 (kde#403868) * Use QTextFormat::TextUnderlineStyle instead of QTextFormat::FontUnderline (kde#399278) * Make it possible to show all spaces in the document (kde#381267, kde#342811) * Do not print indent lines * KateSearchBar: Show also search has wrapped hint in nextMatchForSelection() aka Ctrl-H * katetextbuffer: refactor TextBuffer::save() to better separate code paths * Use AuthCore instead of Auth * Remove dead code * Explicitly link against KAuth * Refactor KateViewInternal::mouseDoubleClickEvent(QMouseEvent *e) * Improvements to completion * Add TODO KF6 note * Set the color scheme to Printing for Print Preview (kde#391678) - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Downgrade the Qt version requirement to build with 5.9- Update to 5.55.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.55.0.php - Changes since 5.54.0: * skip cppstyle indentation test for !t 5.12.0 which has a broken regex implementation in JS * KateSpellCheckDialog: Remove action "Spellcheck Selection" * Update JavaScript library underscore.js to version 1.9.1 * Fix bug 403422: Allow changing the marker size again (kde#403422) * Consistently use override, not Q_DECL_OVERRIDE * SearchBar: Add Cancel button to stop long running tasks * Remove explicit use of ECM_KDE_MODULE_DIR, is part of ECM_MODULE_PATH * Review KateGotoBar * ViewInternal: Fix 'Go to matching bracket' in override mode * Delete copy constructor and assignment operator from public vim/ classes * delete copy constructor and assignment operator of some internal classes * Use HTTPS, if available, in links visible to users * Review KateStatusBar * ViewConfig: Add option to paste at cursor position by mouse (kde#363492) * Use the nicer K_PLUGIN_CLASS_WITH_JSON * Remove Qt version check- Update to 5.54.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.54.0.php - Changes since 5.53.0: * Fix unit test that arbitrarily fails * fix scripting for Qt 5.12 * Fix emmet script by using HEX instead of OCT numbers in strings (kde#386151) * Fix broken Emmet (kde#386151) * ViewConfig: Add 'Dynamic Wrap At Static Marker' option * fix folding region end, add ending token to the range * avoid ugly overpainting with alpha * Don't re-mark words added/ignored to the dictionary as misspelled (kde#387729) * KTextEditor: Add action for static word wrap (kde#141946) * ViewPrivate: Don't hide 'Clear Dictionary Ranges' action * KateStatusBar: Reformatted by astyle command to follow coding style * Don't ask for confimation when reloading (kde#401376) * class Message: Use inclass member initialization * KTextEditor::Message: Review documentation * use STL were no implicit sharing is required * Expose KTextEditor::ViewPrivate:setInputMode(InputMode) to KTextEditor::View * improve range handling, no allocations for common updates (kde#333517) * KateViewInternal: Rename getMouse/Cursor() => mouse/cursorPosition() to fit coding style * tune editing actions for large number of small edits * Only cal updateView() in visibleRange() when endPos() is invalid. * KateViewInternal: S&R- Update to 5.53.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.53.0.php - Changes since 5.52.0: * KTextEditor::ViewPrivate: S&R * KateViewInternal: Remove unneeded functions * Allow negative syntax definition priorities. * Expose "Toggle Comment" feature through tools menu and default shortcut (kde#387654) * Fix hidden languages in the mode menu * SpellCheckBar: Use DictionaryComboBox instead of plain QComboBox * KTextEditor::ViewPrivate: Avoid warning "Text requested for invalid range" * Android: No need to define log2 anymore * disconnect contextmenu from all aboutToXXContextMenu receivers (kde#401069) * Introduce AbstractAnnotationItemDelegate for more control by consumer- Update to 5.52.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.52.0.php - Changes since 5.51.0: * Remove unused variables * Fix minor EBN issues and typos * Fix align of doxygen comments in templates * Use normalized signatures with SIGNAL(), SLOT(), Q_ARG(), Q_RETURN_ARG() * Remove duplicated includes * Use more explicit constructors with internal classes * Remove double underscore (__) from header include guards * Minor: Cleanup some code- Run spec-cleaner- Update to 5.51.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.51.0.php - Changes since 5.50.0: * Restaure default severity * Autogenerate debug file + create categories file * Port to no deprecated method * Paint code folding marker only for multiline code folding regions * Intialize m_lastPosition * Scripting: isCode() returns false for dsAlert text * fix ebn issues * use R Script hl for R indent tests * Unit tests for the R indent script * Update of the R indent script * Fix Solarized Light and Dark color schemes (kde#382075) * Don't require Qt5::XmlPatterns- Trim bias from description.- Update to 5.50.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.50.0.php - Changes since 5.49.0: * Too many changes to list here - Refreshed patches: * 0001-Disable-KAuth-integration.patch- Update to 5.49.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.49.0.php - Changes since 5.48.0: * proper fix for the raw string indenting auto-quoting * fix indenter to cope with new syntax file in syntaxhighlighting framework * adjust test to new state in syntax-highlighting repository * Show "Search wrapped" message in center of view for better visibility * fix warning, just use isNull() * Extend Scripting API * fix segfault on rare cases where empty vector occurs for word count happens e.g. sometimes for vimode_emulatedcommandbar test * enforce clear of scrollbar preview on document clear BUG: 374630 (kde#374630)- Update to 5.48.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.48.0.php - Changes since 5.47.0: * use nullptr, not 0 * add missing const qualifiers * guard updateConfig for disabled status bars * add context menu to statusbar to toggle show total lines/word count * Implemented displaying of total lines in kate (kde#387362) * Make menu-bearing toolbar buttons show their menus with normal click rather than click-and-hold (kde#353747) * CVE-2018-10361: privilege escalation * Fix caret width (kde#391518)- Update to 5.47.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.47.0.php - Changes since 5.46.0: * Warning-- * Use override * Don't use title case for the "show word count" checkbox * Make the word/char count a global preference- Update to 5.46.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.46.0.php - Changes since 5.45.0: * optimization of KTextEditor::DocumentPrivate::views() * [ktexteditor] much faster positionFromCursor * Implement single click on line number to select line of text * Warning-- * Add missing override * Fix problem that font/italic/... attributes no longer work with e.g. >= Qt 5.9 * clang-tidy: modernize-use-default-member-init run - Dropped patches, now upstream: * Fix-font-attributes.patch- Add Fix-font-attributes.patch to fix missing bold/italic/... markup with modern Qt versions (>= 5.9)- Update to 5.45.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.45.0.php - Changes since 5.44.0: * Make it possible for KTextEditor to build on Android NDK's gcc 4.9 * avoid Asan runtime error: shift exponent -1 is negative * We depend against 5.8.0 * optimization of TextLineData::attribute * Don't calculate attribute() twice. * Revert Fix: View jumps when Scroll past end of document is enabled (kde#391838) * don't pollute the clipboard history with dupes * Revert "[KateCompletionWidget] Create configuration interface on demand" (kde#391955) * [KateCompletionWidget] Create configuration interface on demand * Remove not necessary QtCore and co- Update to 5.44.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.44.0.php - Changes since 5.43.0: * Initialize value * Iterate over initializer_lists to avoid mem allocs * Add icons for KTextEditor Document-Export, Bookmark-Remove and Formatting Text Upppercase, Lowercase and Capitalize- Update to 5.43.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.43.0.php - Changes since 5.42.0: * improve line heigh computation try to avoid cutting of parts of glyphs * Fix: View jumps when Scroll past end of document is enabled (kde#306745) * KateView unit test: simplify finding KateViewInternal * Use at least the requested width for the argument hint tree * ExpandingWidgetModel: find the right-most column based on location * Simplify code: return early to reduce indentation depth- Update to 5.42.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.42.0.php - Changes since 5.41.0: * Remove obsolete reviewboardrc file * clang-tidy modernize-use-override * Fix wildcard matching for modelines * Fix Unit Test * Fix compilation * Fix a regression caused by changing backspace key behavior * port to non-deprecated API like already used at other place (kde#386823) * Add missing include for std::array * MessageInterface: Add CenterInView as additional position * Verify if QTest::qWaitForWindowExposed returns true * QStringList initializer list cleanup * Migrate some QRegExps to QRegularExpression * Fix warning about unused variable * Fix syntax unit tests * Fix API documentation about RangeCommand- Update to 5.41.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.41.0.php - Changes since 5.40.0: * Use directly QStringLiteral * We depend against 5.7 * API dox: fix section id * Plugin template: remove bogus translation strings * Fix VI-Mode buffer commands * Remove unused member variable * prevent accidental zooming. * autotests: Remove dep on Qt5::Script again * Fix: Missing dependencies for ktexeditor autotests- Update to 5.40.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.40.0.php - Changes since 5.39.0: * API dox: fix wrong names of methods and args, add missing \since * Avoid (certain) crashes while executing QML scripts (kde#385413) * Avoid a QML crash triggered by C style indentation scripts * - Increase size of trailing mark * add autotests for D8333 * fix some indenters from indenting on random characters * Fix deprecation warning - Remove patches, now upstream: * fix-some-indenters-from-indenting-on-random-characters.patch- Add fix-some-indenters-from-indenting-on-random-characters.patch to fix broken indentation of some languages (e.g. Python)- Update to 5.39.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.39.0.php - Changes since 5.38.0: * Ignore default mark in icon border for single selectable mark * Minor spell check interface fixes * Use QActionGroup for input mode selection * Fix missing spell check bar (kde#359682) * Fix the fall-back "blackness" value for unicode > 255 characters. (kde#385336) * Plugin template: fix name of Messages.sh * Fix trailing space visualization for RTL lines. * fix typo approved by Dominik Haumann- Add 0001-Disable-KAuth-integration.patch * Streamlined way to disable KAuth support from ktexteditor - Remove patches, folded into the above: * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.38.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.38.0.php - Changes since 5.37.0: * Port Document/View scripting API to QJSValue-based solution * Show icons in icon border context menu * Use config.h more * Fix compilation on windows with editorconfig-c-core available * Replace KStandardAction::PasteText with KStandardAction::Paste * Support fractional scaling in generating the sidebar preview * Fix build with QT_NO_ACCESSIBILITY * Switch from QtScript to QtQml- Update to 5.37.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.37.0.php - Changes since 5.36.0 : * Handle fine-grained wheel event in zooming * Add template for a ktexteditor plugin * Add KF6 TODO for missing argument namespace in slot signature * copy permissions from original file on save copy BUG: 377373 (kde#377373) * perhaps avoid stringbuild crash BUG: 339627 (kde#339627) * fix problem with * adding for lines outside of comments BUG: 360456 (kde#360456) * fix save as copy, it missed to allow overwriting the destination file we check if we want that via a dialog, but we still always fail to do so BUG: 368145 (kde#368145) * Adapt unit test to changes from KSyntaxHighlighting framework * Command 'set-highlight': Join args with space * fix crash on view destruction because of non-deterministic cleanup of objects * Emit signals from icon border when no mark was clicked * Fix crash in vi input mode (sequence: "o" "Esc" "O" "Esc" ".") (kde#377852) * Use mutually exclusive group in Default Mark Type- Update to 5.36.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.36.0.php - Changes since 5.35.0: * Fix cpu usage spiking after showing vi command bar (kde#376504) * Fix jumpy scrollbar-dragging when mini-map is enabled. * Jump to the clicked scrollbar position when minim-map is enabled. (kde#368589) * [FEATURE] Option to build & install QCH file with the public API dox- Update to 5.35.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.35.0.php - Changes since 5.34.0: * Add Q_FALLTHROUGH * Add missing break * Unbreak KateSyntaxTest in paths with dots, check only dir entry name for . * Revert "Add temporary debug output for investigating KateSyntaxTest fail on CI" * Add temporary debug output for investigating KateSyntaxTest fail on CI * Remove duplicated path separator * Unbreak autotests in paths with spaces, properly escape " chars * Use explicit flag values or explicit constructor instead of nullptr- Update to 5.34.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.34.0.php - Changes since 5.33.0: * KAuth integration in document saving - vol. 2 - various security improvements * Fix assertion when applying code folding that changes cursor position * Use non-deprecated root element in ui.rc file * Add scroll-bar-marks also to the built-in search&replace * KAuth integration in document saving - Revert upstream feature as disliked by the security team (boo#1033055) * 0001-Revert-KAuth-integration-in-document-saving-vol.-2.patch * 0002-Revert-KAuth-integration-in-document-saving.patch- Update to 5.33.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.33.0.php - Changes since 5.32.0: * Upgrade ECM and KF5 version requirements for 5.33.0 release. * fix debug warning (and wrong pen value) found by kfunk, introduced my me * Expose additional internal View's functionality to the public API * Upgrade KF5 version to 5.33.0. * save a lot of allocation for setPen * Fix ConfigInterface of KTextEditor::Document * Add unit test for KTextEditor::ConfigInterface * Added font and on-the-fly-spellcheck options in ConfigInterface- Enable editorconfig support only on TW and Leap >= 42.2- Enable editorconfig support- Update to 5.32.0 * New feature release * For more details please see: * https://www.kde.org/announcements/kde-frameworks-5.32.0.php - Changes since 5.31.0: * Commit translations from l10n-kf5 * Fix compilation with Qt 5.6 * Upgrade ECM and KF5 version requirements for 5.32.0 release. * Remember file type set by user over sessions * Reset filetype when opening url * Added getter for word-count configuration value * vimode_completion unit test failure * Consistent conversion from/to cursor to/from coordinates * Update file type on save only if path changes * EditorConfig support * add FindEditorConfig to ktexteditor if that proves to be useful, can be moved to extra-cmake-modules, thought I see its use is rather specialized to ktexteditor * Fix: emmetToggleComment action doesn't work * Use sentence style capitalization with label texts of edit fields * Reverse meaning of :split, :vsplit to match vi and Kate actions. * Use C++11 log2() instead of log() / log(2) * KateSaveConfigTab: put spacer behind last group on Advanced tab, not inside * KateSaveConfigTab: Remove wrong margin around content of Advanced tab * Borders config subpage: fix scrollbar visibility combobox being off-placed * Upgrade KF5 version to 5.32.0.- Update to 5.31.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.31.0.php- Update to 5.30.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.30.0.php- Update to 5.29.0 * Prevent Qt warnings about an unsupported clipboard mode on Mac * Use syntax definitions from KF5::SyntaxHighlighting * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.29.0.php- Update to 5.28.0 * Breeze Dark: Darken current-line background color for better readability (kde#371042) * Sorted Dockerfile instructions * Breeze (Dark): Make comments a bit lighter for better readability (kde#371042) * Fix CStyle and C++/boost indenters when automatic brackets enabled (kde#370715) * Add modeline 'auto-brackets' * Fix inserting text after end of file (rare case) * Fix invalid xml highlighting files * Maxima: Remove hard-coded colors, fix itemData Label * Add OBJ, PLY and STL syntax definitions * Add syntax highlighting support for Praat * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.28.0.php- Update to 5.27.0 * XML files: remove hard-coded color for values * XML: Remove hard-coded color for values * XML Schema Definition: Turn 'version' into an xs:integer * Highlighting definition files: round version up to next integer * Support multi char captures only in {xxx} to avoid regressions * Support regular expressions replaces with captures > \9, e.g. I (kde#365124) * Fix rendering of characters spanning into next line, e.g. underlines are no longer cut off with some fonts/font-sizes (kde#335079) * Fix crash: Make sure the display cursor is valid after text folding (kde#367466) * KateNormalInputMode needs to rerun SearchBar enter methods * try to "fixup" rendering of underlines and stuff like that (kde#335079) * Show "View Difference" button only, if 'diff' is installed * Use non-modal message widget for externally modified file notifications (kde#353712) * Fix regression: testNormal did only work because of test execution at once * Split the indent test into separate runs * Support "Unfold Toplevel Nodes" action again (kde#335590) * Fix crash when showing top or bottom messages multiple times * Fix eol setting in mode lines (kde#365705) * Highlight .nix files as bash, guess can't hurt (kde#365006) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.27.0.php- Update to 5.26.0 * Remove accel clash (kde#363738) * Fix email address highlighting in doxygen (kde#363186) * Detect some more json files, like our own projects ;) * Improve mime-type detection (kde#357902) * Bug 363280 - highlighting: c++: #if 1 #endif #if defined (A) aaa [#]elif defined (B) bbb #endif (kde#363280) * Bug 351496 - Python folding is not working during initial typing (kde#351496) * Bug 365171 - Python syntax highlighting: not working correctly for escape sequences (kde#365171) * Bug 344276 - php nowdoc not folded correctly (kde#344276) * Bug 359613 - Some CSS3 properties are not supported in syntax highlight (kde#359613) * Bug 367821 - wineHQ syntax: The section in a reg file isn't highlighted correctly (kde#367821) * Improve swap file handling if swap directory specified * Fix crash when reloading documents with auto-wrapped line due to line length limit (kde#366493) * Fix constant crashes related to the vi command bar (kde#367786) * Fix: Line numbers in printed documents now starts at 1 (kde#366579) * Backup Remote Files: Treat mounted files also as remote files * Cleanup logic for searchbar creation * Add highlighting for Magma * Allows only one level of recursion * Fix broken swap-file on windows * Patch: add bitbake support for syntax highlighting engine * Autobrace: look at spellcheck attribute where the character was entered (kde#367539) * Highlight QMAKE_CFLAGS * Don't pop out of the main context * Add some executable names that are commonly used * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.26.0.php- Update to 5.25.0 * Qt >= 5.5 is now required * Do not ask for overwriting a file twice with native dialogs * Added FASTQ syntax * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.25.0.php- Update to 5.24.0 * Show Scrollbar Text Preview after a delay of 250ms * Hide preview and stuff on view content scrolling * Set parent + toolview, I think this is needed to avoid task switcher entry in Win10 * Remove "KDE-Standard" from encoding box * Folding preview on per default * Avoid dashed underline for preview & avoid poisoning of line layout cache * Always enable "Show preview of folded text" option * TextPreview: Adjust the grooveRect-height when scrollPastEnd is enabled * Scrollbar preview: use groove rect if scrollbar does not use full height * Add KTE::MovingRange::numberOfLines() just like KTE::Range has * Code folding preview: set popup height so that all hidden lines fit * Add option to disable preview of folded text * Add modeline 'folding-preview' of type bool * View ConfigInterface: support 'folding-preview' of type bool * Add bool KateViewConfig::foldingPreview() and setFoldingPreview(bool) * Feature: Show text preview when hovering over folded code block * KateTextPreview: add setShowFoldedLines() and showFoldedLines() * Add modelines 'scrollbar-minimap' [bool], and 'scrollbar-preview' [bool] * Enable mini-map scrollbar by default * New feature: Show text preview when hovering over the scrollbar * KateUndoGroup::editEnd(): pass KTE::Range by const ref * Fix vim-mode shortcut handling, after behaviour changes in Qt 5.5 (kde#353332) * Autobrace: don't insert ' character in text * ConfigInterface: add scrollbar-minimap config key to enable/disable scrollbar mini map * Fix KTE::View::cursorToCoordinate() when top message widget is visible * Refactoring of the Emulated Command Bar * Fix drawing artifacts when scrolling while notifications are visible (kde#363220) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.24.0.php- Update to 5.23.0 * Fix default encoding to UTF-8 (kde#62604) * Fix color configurability of default style "Error" * Search & Replace: Fix replace background color (regression introduced in v5.22) (kde#63441) * New color scheme "Breeze Dark", see https://kate-editor.org/?post=3745 * KateUndoManager::setUndoRedoCursorOfLastGroup(): pass Cursor as const reference * sql-postgresql.xml improve syntax highlighting by ignoring multiline function bodies * Add syntax highlighting for Elixir and Kotlin * VHDL syntax highlighting in ktexteditor: add support for functions inside architecture statements * vimode: Don't crash when given a range for a nonexistent command (kde#60418) * Properly remove composed characters when using Indic locales * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.23.0.php- Update to 5.22.0 (boo#980066) * Use proper char syntax '"' instead of '\"' * doxygen.xml: Use default style dsAnnotation for "Custom Tags" as well (less hard-coded colors) * Add option to show the counter of words * Improved foreground color contrast for search & replace highlightings * Fix crash when closing Kate through dbus while the print dialog is open (kde##356813) * Cursor::isValid(): add note about isValidTextPosition() * Add API {Cursor, Range}::{toString, static fromString} * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.22.0.php- Update to 5.21.0 (boo#974793) * Revert "Open/Save config page: Use term "Folder" instead of "Directory"" * Open/Save config page: Use term "Folder" instead of "Directory" * kateschemaconfig.cpp: use correct filters with open/save dialogs (kde#343327) * c.xml: use default style for control flow keywords * isocpp.xml: use default style "dsControlFlow" for control flow keywords * c/isocpp: add more C standard types * KateRenderer::lineHeight() returns an int * printing: use font size from selected printing schema (kde#356110) * cmake.xml speedup: Use WordDetect instead of RegExpr * Change tab with to 4 instead of 8 * Fix changing the current line number color * Fix selecting completion item with the mouse (kde#307052) * Add syntax highlighting for gcode * Fix the MiniMap selection background painting * Fix encoding for gap.xml (use UTF-8) * Fix nested comment blocks (kde#358692) * Upgrade Qt version requirement to 5.4.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.21.0.php - Drop upstreamed 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Added 0001-Fix-Clazy-fix-mistake-that-broke-selection-handling-.patch- Update to 5.20.0 (boo#970856) * Fix highlighting of all occurences in ReadOnlyPart * Don't iterate over a QString as if it was a QStringList * Properly initialize static QMaps * Prefer toDisplayString(QUrl::PreferLocalFile) * Support surrogate character sending from input method * Do not crash on shutdown when text animation is still running * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.20.0.php- Update to 5.19.0 (boo#967668) * Better behaviour for "insert braces around" autobrace feature * Change option key to enforce new default, Newline at End of File = true * Remove some suspicious setUpdatesEnabled calls (kde#353088) * Delay emitting of verticalScrollPositionChanged until all stuff is consistent for folding (kde#342512) * Patch updating tag substitution (kde#330634) * Only update the palette once for the change event belonging to qApp (kde#358526) * Append newlines at EOF by default * Add NSIS syntax highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.19.0.php- Update to 5.18.0 * Syntax h/l for pli: builtin functions added, expandable regions added * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.18.0.php- Update to 5.17.0 * Add syntax highlighting for TaskJuggler and PL/I * Make it possible to disable keyword-completion via the config interface. * Resize the tree when the completion model got reset. * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.17.0.php- Update to 5.16.0 (boo#955067) * highlighting: gnuplot: add .plt extension * fix validation hint, add hint about the compile time validation * Don't crash when command is not available. * Fix kde##307107 * Haskell highlighting variables starting with _ * simplify git2 init, given we require recent enough version (kde#353947) * bundle default configs in resource * syntax highlighting (d-g): use default styles instead of hard-coded colors * better scripts search, first user local stuff, then the stuff in our resources, then all other stuff, that way the user can overwrite our shipped scripts with local ones * package all js stuff in resources, too, only 3 config files missing and ktexteditor could be just used as a library without any bundled files * next try: put all bundled xml syntax files into a resource * add input mode switch shortcut (kde#347769) * bundle xml files in resource * syntax highlighting (a-c): migrate to new default styles, remove hard-coded colors * syntax highlighting: remove hard-coded colors and use default styles instead * syntax highlighting: use new default styles (removes hard-coded colors) * Better "Import" default style * Introduce "Save As with Encoding" to save a file with different encoding, using the nice grouped encoding menu we have and replacing all save dialogs with the correct ones of the operating system without loosing this important feature. * bundle ui file into lib, using my extension to xmlgui * Printing again honors the selected font & color schema (kde#344976) * Use breeze colors for saved and modified lines * Improved icon border default colors of scheme "Normal" * autobrace: only insert brace when next letter is empty or not alphanumeric * autobrace: if removing start parenthesis with backspace, remove end as well * autobrace: only establish connection once * Autobrace: eat closing parentheses under some conditions * Fix shortcutoverride not being forwarded to the mainwindow * Bug 342659 - Default "bracket highlighting" color is hard to see (Normal schema fixed) (kde#342659) * Add proper default colors for "Current Line Number" color * bracket matching & auto-brackets: share code * bracket matching: guard against negative maxLines * bracket matching: just because the new range matches the old doesn't mean no update is required * Add the width of half a space to allow painting the cursor at EOL * fix some HiDPI issues in the icon border * fix kde##310712: remove trailing spaces also on line with cursor (kde#310712) * only display "mark set" message when vi input mode is active * remove & from button text (kde#345937) * fix update of current line number color (kde#340363) * implement brackets insert on writing a bracket over a selection (kde#350317) * auto brackets (kde#350317) * fix alert HL (kde#344442) * no column scrolling with dyn word wrap on * remember if highlighting was set by user over sessions to not loose it on save after restore (kde#332605) * fix folding for tex (kde#328348) * fixed kde##327842: End of C-style comment is misdetected (kde#327842) * save/restore dyn word wrap on session save/restore (kde#284250) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.16.0.php- Update to 5.15.0 * Validate more regexp * Fix regexps in HL files (kde#352662) * Sync ocaml HL with state of https://code.google.com/p/vincent-hugot-projects/ before google code is down, some small bugfixes * Add word-break (kde#352258) * Validate line before calling folding stuff (kde#339894) * Fix Kate word count issues by listening to DocumentPrivate instead of Document (kde#353258) * Update Kconfig syntax highlighting: add new operators from Linux 4.2 * Sync w/ KDE/4.14 kate branch * Minimap: Fix scrollbar handle not being drawn with scrollmarks off. (kde#352641) * Syntax: Add git-user option for kdesrc-buildrc * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.15.0.php- Update to 5.14.0 * Merge allocation of TextLineData and ref count block. * Change default keyboard shortcut for "go to previous editing line" * Syntax highlighting Haskell comment fixes * Speed up code-completion pop-up appearance * minimap: Attempt to improve the look and feel (kde#309553) * nested comments in Haskell syntax highlighting * Fix problem with wrong unindent for python (kde#351190) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.14.0.php- Update to 5.13.0 * The Qt version requirement has been bumped from 5.2 to 5.3 * Debug output has been ported to categorized output, for less noise by default * Docbook documentation has been reviewed and updated * Guard default log level for Qt < 5.4.0, fix log cat name * Add hl for Xonotic (kde#342265) * Add Groovy HL (kde#329320) * Update J highlighting (kde#346386) * Make compile with MSVC2015 * Less iconloader use, fix more pixelated icons * Enable/disable find all button on pattern changes * Improved search & replace bar * Remove useless ruler from powermode * More slim search bar * vi: Fix misreading of markType01 flag * Use correct qualification to call base method. * Remove checks, QMetaObject::invokeMethod guards itself against that already. * Fix HiDPI issues with color pickers * Cleanup coe: QMetaObject::invokeMethod is nullptr safe. * More comments * Change the way the interfaces are null safe * Only output warnings and above per default * Remove todos from the past * Use QVarLengthArray to save the temporary QVector iteration. * Move the hack to indent group labels to construction time. * Fixup some serious issues with the KateCompletionModel in tree mode. * Fix broken model design, which relied on Qt 4 behavior. * Obey umask rules when saving new file (kde#343158) * Add meson HL * As Varnish 4.x introduces various syntax changes compared to Varnish 3.x, I wrote additional, separate syntax highlighting files for Varnish 4 (varnish4.xml, varnishtest4.xml). * Fix HiDPI issues * vimode: don't crash if the command gets executed in the end of a document. (kde#350299) * Support QML multi-line strings. * Fix syntax of oors.xml * Add CartoCSS hl by Lukas Sommer (kde#340756) * Fix floating point HL, use the inbuilt Float like in C (kde#348843) * Split directions did got reversed (kde#348845) * Bug 348317 - [PATCH] Katepart syntax highlighting should recognize \u0123 style escapes for JavaScript (kde#348317) * Add *.cljs (kde#349844) * Update the GLSL highlighting file. * Fixed default colors to be more distinguishable * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.13.0.php- Update to 5.12.0 * debianchangelog.xml: add Debian/Stretch, Debian/Buster, Ubuntu-Wily * Fix for UTF-16 surrogate pair backspace/delete behavior. * Let QScrollBar handle the WheelEvents (kde#340936) * Apply patch from KWrite devel top update pure basic HL * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.12.0.php- Update to 5.11.0 * Allow like in KDE 4.x times 3rdparty apps/plugins to install own highlighting XML files into katepart5/syntax * Add KTextEditor::Document::searchText() * Bring back use of KEncodingFileDialog (kde#343255) * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.11.0.php- Update to 5.10.0 * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.10.0.php- Update to 5.9.0 * Add kdesrc-buildrc highlighting file * syntax: added support for binary integer literals in the PHP highlighting file * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.9.0.php- Add explicit kiconthemes-devel BuildRequires- Update to 5.8.0 * Add word count statistics in statusbar * vimode: fix crash when removing last line in Visual Line mode * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.8.0.php- Update to 5.7.0 * Fixed high-precision touchpad scrolling * Do not emit documentUrlChanged during reload * Do not break cursor position on document reload in lines with tabs * Do not re(un)fold the first line if it was manually (un)folded * vimode: command history through arrow keys * Do not try to create a digest when we get a KDirWatch::deleted() signal * Performance: remove global initializations * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.7.0.php- Update to 5.6.0 * Fix build on MSVC. * vimode bugfixes * add syntax file for Oracle PL/SQL * ppd highlighting: better support for multiline values * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.6.0.php- Update to 5.5.0 * Fix kde#340212: incorrect soft-tabs alignment after beginning-of-line * Add libgit2 compile-time check for threads support * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.5.0.php- Update to 5.4.0 * Implement "go to last editing position" action * Guard against a possibly broken code folding state on disk * For more details please see: https://www.kde.org/announcements/kde-frameworks-5.4.0.phpobs-power9-13 1652317863  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMN5.90.05.90.0-bp154.1.385.90.0-bp154.1.38 KTextEditorKTextEditorAbstractAnnotationItemDelegateAnnotationInterfaceApplicationAttributeCodeCompletionInterfaceCodeCompletionModelCodeCompletionModelControllerInterfaceCommandConfigInterfaceConfigPageCursorDocumentDocumentCursorEditorInlineNoteInlineNoteInterfaceInlineNoteProviderLineRangeMainWindowMarkInterfaceMessageModificationInterfaceMovingCursorMovingInterfaceMovingRangeMovingRangeFeedbackPluginRangeSessionConfigInterfaceTextHintInterfaceViewktexteditorabstractannotationitemdelegate.hannotationinterface.happlication.hattribute.hcodecompletioninterface.hcodecompletionmodel.hcodecompletionmodelcontrollerinterface.hcommand.hconfiginterface.hconfigpage.hcursor.hdocument.hdocumentcursor.heditor.hinlinenote.hinlinenoteinterface.hinlinenoteprovider.hlinerange.hmainwindow.hmarkinterface.hmessage.hmodificationinterface.hmovingcursor.hmovinginterface.hmovingrange.hmovingrangefeedback.hplugin.hrange.hsessionconfiginterface.htexthintinterface.hview.hktexteditor_export.hktexteditor_version.hKF5TextEditorKF5TextEditorConfig.cmakeKF5TextEditorConfigVersion.cmakeKF5TextEditorTargets-none.cmakeKF5TextEditorTargets.cmakelibKF5TextEditor.soqt_KTextEditor.prikdevfiletemplatestemplatesktexteditor-plugin.tar.bz2/usr/include/KF5//usr/include/KF5/KTextEditor//usr/include/KF5/KTextEditor/KTextEditor//usr/include/KF5/KTextEditor/ktexteditor//usr/lib64/cmake//usr/lib64/cmake/KF5TextEditor//usr/lib64//usr/lib64/qt5/mkspecs/modules//usr/share//usr/share/kdevfiletemplates//usr/share/kdevfiletemplates/templates/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Backports:SLE-15-SP4/standard/1341c6e10b624967dd590bc9eb5ad14e-ktexteditorcpioxz5ppc64le-suse-linuxdirectoryC source, ASCII textC++ source, ASCII textASCII textPOSIX tar archive (bzip2 compressed data, block size = 900k)Pdup\g utf-8076c927b8476f7edd783c06be45f0c9fd9e5aa62b6dfa9b1b184639293655ce7? 7zXZ !t/a] crt:bLL &p;ՋYH>`~۸ ̍:[%gr_bQӠ gIs@2587oZ*1tܶF/uf)ӳ+Q.-eË~togIJ(C:x?|| 0YmPtFp.r5n_ujX *)X??`_0ZCf<*Č\T8ry={8gMO^g>1D~6-U-eńh9MP!UbʱM ō*ڏfG-r2wMvie\vY{Ure7 BTY֍蚲35M~9 uhTig :sx3Tq$dD_߮ 6 m:=_51<([BTEc+MbxaŘ FbZu#^ߩwdoq,GKis⩅K5lݪ\oC1CÁ}wˆ1{\L5sU&k~۞-*Fڹ!EuDG=hRHorבi@ԃŔZ%3bWs| pv|*{Щ)ӥ;Fȯ2ϵG_I)'!vL&*Q4h(1ch.Nɬ*b$˔2θ[<휧71OK8>>;$~- uf$ZQoU6l,őTf$zoS=J:@ǎl;?M|pkZ]]ra;H sٕ_ ѭ T q?k&_Nԇ +}9| s|A Rk}d|fr3 V.c,dJ\Hj2>!aF}LZ-ڰ$Ÿ5K"IE<mQkըNR67aA>ls+E7aP%w}&„J*GuYN (CICCv!a 1e0 i(;7JEV!*o춪rm?[)u )ް 8F7.dhmvU&Fkoy iLVk#d}U@1cf/Q*U~8Y|1t <=Plw@)乿ZNeH ]}S{L׹kdK^ P#xq d7O g֠,ʚe!'@"+.^U}Ld_#zKZFOlC9 $!m+odH94RB27D<.G1'#jB2q=iI `'cxE^,F1uBaCd,gFj4dzin8CN [ԀTy8_$#j]CGɶM +B U4d{5 ^4+(.1 hYLI(!¸2*6cf萎fZ-a<QX|jپ>Mq)R;-҅뗝˴Uvؑޘ-$%X[TXK#K $PvkZ#cށkKb@V;^-.቟hpf::I=}" VmՍ'bxp*x <݌ FmIފb4Ndӏ(b l5gk#Z%#e>@əiK/5"Puna9$] ˈ2ʻ¤Uۻzbԓ?%7";Sz/e=sAaZ˲m|9i =40g`9ڊ\ؓԡY/F嫋[BIY(Б)|݄2aifQqkHD &_(]ne?/ӻv'eF xxX6`:uT yݞzدlxmbQH/ew=ͯ/NS9p^{7A %ggaRK+_.2pH>($loigZn7@JOC>0˩谼{*WQb.dUEp*?H[QU j{'ƤܰI)F޸aQ"4T]1ߐ$ľP~2Wk17@wB6<Sjȣp buF sVVZ=':Sq),Q !^4f o6EIN3@3fDHaG;QsFuMLYE }b;֤H>&:8_ڼbq{65&5:9 1c|^h.%5o-Tv xws9O1L|Wk)SwK4Oi\?[3Jf+C]?]6zzɭ_[w%wB/^>`1 @Hڦr/:-QqsfFў6F}y]^GMﯮ ں2;`TJJ[!bC1t'o{KIWMvSe.»l#]@4G$F$5ĈWm{„>x$>Ͷ Zud_}GfD;$ *Elf8ڂK9Nȷ4lsq]7. O Cc͖ /܇IlJp+@OF0v7̄82AsW}*q-], `' ~x?2ƽ5=oD"1afu/_4fwilp$UI%y.Խ y@) Du=%y]aGxMKK[0KFbvd!,~v(I-ST" ~V5W^۟sM%&XnZ (XURTK`s}1`^[6KmUpށ%4Sbm q]~рta4&/St9K<aL>G稈=~+<(ۑ[^1)iಡv :]z\zp"ac졐Pн pRorrnAsa][I2Oc4/.nUJE]|b.(Q" $_?d2bBeIEp1(ㄡ7LR( uR/rLrBMt";f,{?h% Ei{7*}\>/ h3’Ze?];_ )svČ4adÚ)DP$;CldnaC̴I8b-Q4/V,hq;)U7V3Mˇ#՟n z&p懟nB+~wHX6letk B-ҠPS0DIv=?̱ SW'J7մo7Xd4ѱNzcQ, {Pq" 6̧Mh9W!( αPN+!bEhə&j<ZE_u}nx;Ii4B͘B {0 @HڨCOLU#qq?rz3fe~םM9Zj `/XBƵB7|5)dkcR%߾tOJᗏsVՑZGrw>nod|WFtWz.wۧ~a@Mq΄q-mt~%aB;F%`$sœ+cC50D;壼hwSM& YV[js,өI)aȄe0- mD]9`BD\cI݌B\.$OL NҸ{SM̌oӥ %2CaecM׉f[#yu/1`Xۢg.2GwLD gsr"$J4FFѻx(bBT11KV14i3n!ޒȉ)vCmW 48<Qp!:# $SզνoW4*6`"w(\<"WO > 4#(oWRmQKQhdQ8<Ŋ]~W)0æfd=F0;J.N`/; oÕȅ f9|%:+amr V#َ7+@ä4AS6Z64`=Ui#HhѵW8Qv8RK q*8#!⩄Ԗ.<)^s 蔜)E\'y8ۿn8 7q7:"bp]T#ϩ?@!E`/!XɽQu/\jD]eDKU 0\krdgE擦g> \Y#\-SGG֞8m鼓3S9Lzmʳ\"Қ!V|벵}I8|\:iOC^t(Fa*2.h30~X2ď k9jzk`xUH }yFN ×=S.Oc ]1O"\ҭf#I#hRIP֞wLmR%()[Oߋm T$(B ܇Ca!?lEmdPSD%,Uj\*đF &0ƊojLVqE#?HE.L ܻs{4`H:߸@|ӝh8d3u5藂p~%Y$F;VKgZ+@T_Zp;*s0K5 ToBFgP6 ?Q]klp_8C+2'],=2V@H NƊkBr y'y /c%z/+9pTw,ܭ~`- wqi4 ra@n>7z1Ʀ]dFpAa&nX Rg[8.Qvw&DD L½9RT[w>֒Z94Yvl4(#B;v9!A`~fM'= RǍ﹒sNSp(oHt AbPk.2cH{TQs]r <@=@K}`wqwmXh>ǩ"ަ_4TIw6^SܥTƠ1hV"+(ɂp#6Z0%;xĚ偤ZoBNfԾ9P) 71L{+cB2޲.\sЮ 4+&=p,ܓ >r)yFF:P[Iuzڝ1}Vwt\gqaxVW, M˭pn'+pu+l]͏Ey¬EWJ& O%6^N&ʓ"oTvJo,\gCg=Js-W0Fa媱ϫwTt! rx}W@/7 ZlZBcxjt8L]ڰn@+ GoI Spckm#i!Ml!&+|- Ž ȯk!˯t.ucGVD/7}\M|#ͮ_ ZMUh*(~y BAKàE򱆁hV 0rF#z'h_OOܣyHiTm&fYxw͆`S D'H p2edJFOɫ18͡syyQıA!߳PDy m c0B`1ʱs- SpڬCذ&}eGξ7ؕGO,18ظyeNM *"V}9r+  AW3s˃#M<8go~K&;.9,^ 0YN7 9_sydɹRG1c9ɓ) ON<vl@GS/Ql5KyHgoT5'FɎ- |5 ܆BYQh4܄H潵{ke0u9585}n#32(.nӎ@L\WVǍISk…e{sBs]~\_0ŃVb0`n>{!΀rM9WZg~IAᰞKclx4{v*dU {/fWnid؁+E3 f X§TD=n:yg ,Ŕk mZhEv;r`S0DJ/n t_Xt'SFWY6yzDf܈JGvE J-)&$Fs:ͫ4뵭&2ssxfY<[};Oqನyسh8yhdDw_^M ptF_ dҎNb9^5=v&N!FFurR0wN&jm)s1`nU1+<*f*i,\+)T:KF&śP;{Yqz KH X*;qUW^GNDY:&`6.M \rT~٪N0je?C'sP`A=ק| tKs4DC9-I/].@J~W]V5p)b| Ьj| 䊲cK3_.d7Td8&Ls?`"ys,,AG5PVK9WP7 ZPQ;/=4R~~: %_%j}:zgv$|ὲ.ϸnիx҈:۱:6Xϼ=PJ}vT7ʺ.>mS(| 0zZ\y5e2 ;9ܻhQZ0F br ]؂U7YesZ7Sh}2K$< Fc]¬*-uj?GRMP6Ҵ8ZY=- 8I/g̑jzЌ C׾9cD`1@xF&d7Zjw%G h%jWEixz19mO"+'i[$YC55ÿehp ?W.cR&ВF2jڢjjnE8Gou*7[V-Ζ@^Dn?74b]Vt"6Mh࿷i"|Yd﷉r_''_D)7MT\8b RsE$dɢwWHWAhf!}XݴcBU{ʂQpMXHG^tqj +[1$Ő#XY@ٞ2m62h& oidW #ScM&pR˺9 Yf'PSհċOV5I/qOmmbF@c/HrCfSJp00&Ҷ%VY}c5g ]+B \A?@=MqU՗#G.\U.ٱ`a7adzv}RYԔߞNXD|n]`hN_WffVyֹڗU##y&3wuY/@޹eInOyfRyf]πl㍗ ZM6Rb?o|`j|ٹrjivfccx<ڠr2wNEeіdO{ݮ7FhY2øh Ǎ=$C̓*\^h\c JT15˷v^s/<Q흺\sXPyzsB_Ԝ@3AZr!Ɩhg@pJkN, Ho6MSqI9,ed>ij6MZ_sFu QH _2WO}IȐWBmpg(5[71Ֆ)\\g𽣞6(L"X[Ƕ*OX gId;l_w#Ɵ<]Qz陨W,d GO⫽GI6f+5IP`c)F!QǑDJj@1Ur4"p9 ein!⡰,bsgh`|ʡv)so;8 a$\"3\_S;z-#SySd­=h\v[Y$ȈFp1jn'i>}ϝvm܆F:̧Pp ru_w s %O+H[J5S3 I;5IQw..jt^缀ۏBR zOk߀@/A$aw 0`%uJR,wpC 0 G,H{zNJuy퇍 N+jw{8|꫹>58^4N y1k=6C5Zy+w ! :s VE^ /´= [|'1@!zSЮ>-f[b`O@޿hmP3>OAtq`2H.pLn1- )"A}u|SxDNKտa!e H i7RAh>}R̖2-o|$¦ƙ:z^ŭw mKcN7Zב83WmU7.6Zag:KҴ&d4ӟBq; т4C͵5҄eLԯ6aTxHC<y< ϟH. 52 #dq@6l XRGziLX1*D(]MҙPe_:Qnr`flx^.NIƻ$"2D<4@0zw"+Uk/d$xA}lGj{ +o8PvtR3J<%{o 6;̱#uU"Z{J&j~q-4S&lr𦪘-S" ᦣKu۫VucFY~@a`U!2s3G[-S~ wG`w / /u#$ _ۖ0nb:}_ߝ4-\(^O^‹u?<]\o\dЪo0{6CךE9 4iu5j8 4C&;J={iOU7:.݄3""k؟ghq!!&3mԆ7phf9&/JYwF[)x`|KX%)&P[?^=bi 9{i9`l`#řKWwXwj1t2t?!wRF4fͶ"Yp֬}F9ۓ2oC*&АGVJGnR{M}Ot.VeK!0Gqk|2N9,%: m<]ͺKDf]S:mZ7SnN ^G׿zXf4LIsi3mUdGB-2xil# 5r2OvU`i~f2wX{.p&0nia]~\$&F:Nr6xٷoNW?1 Plou=A4 eC|{ŵt$\B5w1g;Ao`W=nz~u挒Z&1qRJL] M ɨ6H1rA: 霬5}=A8^/W]ح4DFhN XHorO-Yg۱<@E[} m1EW65y v<)iE$w5!!Ҝ)95sOI ^KC€b,v`gԸ:e&ZdYQ91@2NնX=Q1|D\/wUwWP7"{%% admLn:ΰ2}0GS |%'}n$e,kZxչ'˕L4p=h\^I##oc 5_YIӞ*z)Gl\p#XQkĆT|?ټoP5fme8)Qts`7FCHs:/ȎMà fo7LJ t L颍^euY!|FW 9w=^ zTvՔU5w$CPq^P!K0҆~ Kխ [Vi 4+Ǚ}EHF.N :`&Ӷٰ0}e[# B0Q^|y+X*U_s|CȚLe_8uknPY]dîLfIJH'_}f ͨ`e+.JҰ6[{Q#ۅU:Жb 9I\8gi#'(z4 K wsZ "0QU+{Z5X2ԕLHDEnrN'z18\ y',ak{8"_=gǝ"c.x>@7(ήkЅz;_Vo 9`\z{ACC+׻(30#?x;v(̥9#ɔ'?ê( @.pfC ][\ϯ,_UT=bb #s[>Ȋ7r`,0IOZ#ﰂ2pJ)XT!|hAvڮuu[M7hx\=-"dlN&Uh欕eF91a;w)y (nyQKQSShfIPaw(FX竟3WIdtspMS##|adiQج=%)H*+B(jðfr_N_#ZMa{6qƊ+}Խ9siauE1b9E+I ͡3|lZŃQ'D@!L q8F&ftW2ylVTU0, +4 A0 xo=sQN^#*#\ &B|}ע1ᨇ'ZJt-&twFTRcl`D e͹~7m2`FOE^lz" }[v ft?U;E?fa[$% $ :j{}@5j)ѷl2lV?^L왫nVh9BYy'QPákB퉽 ꭉd lg.3qM'3MF$* _IiFP-x?m*%HUQ1/W@p⮎¶}ܾlt_ln- NMXDT1쭧q'}|R}XJHu<#GWyl̤*xal!p=4»XZPV~ 6%{#b\9!:M7@Kߚ`}Zu1xb46ĵi㐲7~  c~|/*L(X"R:nV'ԲG$HNA1ejhG4>$^~ƻVbPsմQ=8f`ƹKCX@?!#vQqx;"sq:5˧l]1$ 7⤴afMdIXv6rEfI[ȥ8ASXT&ysGa,/HVLVv G$dI\J`t\Sİ'*KDo^\kЇ5+& _pc.݅CBp ❽46@,:dg!BZWXos|4T=71чVn:MӢ4~]B5īT!4et.fUGgN9ZFFr="&7 >l:sf,'7S%yY( 9Z m 2,Se Nr4TTT*)~i+"g"SDI+c :/x.Z8ӁU}  yu9*Z&JB\$izCMǚFn޴^ACflGoԕoCs v"_G46=F"/Y熍 YS,r}E{vΏq=oenelUkm\+xT٢NOhzRRAn3^\6T&iu"K]U$ Hݝ^\)d+/5cr}YIu3dU賣(6Ot5?.&`VɯѹX`D1A=/'s'!GUtHHrLQìzo gzu ]oLGtHzem ᪀ө! 6'I9igާ&RkͶt 8/ViGl"䐀#lfXKDYԑ5ߺ+xئ7k" VTn4bجZC'cMEK=J C}>Ⰽ$R@ub_w7N.#|Ur|G! #tP.Mѳ(ms eՑ3mW+C"0|a{H]T {b.EDjXNAM޷4͎g,@=}C}4h֋O=̷Pp͎ќ` fu;A8( qz~WYmkRB?Ԁӏ Er YG[s wToϭMdOcnxohFȎ`$T9DZT}>n|/w1P ]΄vX;:ŵ]ӌ"t _UvÌاhs7:AygCk?y4^K1`@H=FCj0~B Î-mT=<)}FCDH4 Ff⟗om UjN:_iKU[5a?D ]3}଒>~(krHUޛ \h*PC[xr ;Er1*W& x>[fvV;H*hc3 ěI <~qFQa"Cqoi\?QD7 9ӡ,t5?vX UR#h BsVQB Fī'幀i唈Vxp. ~g ^'9 g2;hO@,,B<6 2a$23}{0_ƙB!ÆW?p:UuؔNj=T7\-aqՈ}K"#aW Vޠm/[ A%03R> ϏL.0c!qUX}bFy и|}Po0UڅWAʈS1V)Ś wHGfS*4%`xn" Re"Io8uS 8S:DpN ڸ0`({0-U͆xȞᐽ2fb_&O6\iZLY=rл` fr9*V[] O7=8c$3o p|8^]{eļ'd5Ju[@M#)9$"LҮ^ --B8C&P^,{3L H2إc`FyQf͗>fO&t``T\ƂH'^ЇX,s+|7ݦ Gg'LGY6ⱙ)A#ᴾR煘'Y%2S{br)F_9 Cr$7"fL̠[1;~gDy!U|y=;3E)(?\ijf ҶTW[9ptr: h>X43)h%N>G 8SM2/c%,9CB!=%lԑ|{C«hRD6}IA 5DBa e'=[I4XR1"z9iC˟PezP2Έf"oOwbPk}%eMľ85&kBg?q-hx?NHUn&_*Gw@h8> |y>TٶZBo֝$ oV[]9H1EUͯ^=SA]n8ș"L yr+#䟺v)}}n9Q{ O&4r eZng-p,E͚һ`}ߛgvNТfUYHƢ%Qo{Jl@&K"~/9'y(';(o8n/7Ym>MiMg7#x͘#N3们$\ C9jZeޔUOu{@VAgoF7ZW-5up4}#XxepG{4S+OD\Y2<Ī/89=u(Β(-IS`ic$ї K[s{Y:;uY^e aB&pPp^s4Mm튆FH0vC `جxd3IȲZl&}7+9}5X5DSY.4 pصtbfG}Xd5ei{%6NͧևgOEi&2Nc7|Su*܆E Sfl9&7߷*3ɲ飺ѓװ@DH1\˩GbrXzR01P?1sîBUHr_Oq˩Vbc 6`o YI1$wk-QAƲ/_jg)/㛔g!J7eg0sǢuןLYT4D(kOpߵ}{uٳ )Pa>֝#bj8m>m2=_HVW}(!)c|0h7'z8?[*r'G m*rx(-"Wνm.W=v3l~RM0CIn~>FTo$ꆽ,&r)*N61XU7:5U۝RJ`1ER6F:R~PY guA _{h`yi‍  7v&0q.C6 l58@?>AӃ*TVqP:_FϜAH "HY5"]42_eׯv MY李oظi͌IoʦUzAKA>opYg hPB=gP{%ں zt;X sOO.*NҐ=Lٳq@V潇8{ V`$v7-t8"قu7B'QJhWk KCjＳ.Fċ7=HZ/O~rN7!W\}4?`Lol4aďÐ:>r$S8|&ː<}˦RV^&J{(:=> rKJKaKdžut/`@{yr^ƨ xsd!@'`O$LK9 >9Tq]I$9vV*v$y>@p;0mj0h>|i`10O71tCk~JGR;I# @ަLr7̉SX[jsBzMj=9U\u߈!Ziqd B8hgxG'2!&m:FpψfV蛭5VcHReXx zl[d9K~Ck!u_s8QS9Bұ1veDԇlS~B׌RIzJKe ^nn]xCk1UL}*sU@>?1?CLz MB}(Kp'ZX0JcDiRK SN,"4&.t9uʨ\ye_G;(!U}͎t>[޷!򩾄O`J]xR'еJJ_IYmtl< 6{swXj'q1s,x^\QlgrC%<M*ff`z իEpCǸpna&> < ̹*U~6)W Hf@vE ]lsdOO$U˟ǞXJM(r_JM`se^UY3|- aK*'|%yx ENl6LIDutmۚϙpPVqoxpO(TC+ v Gm!'\7XXkq.hdRG߾s(lEΗ&,Tu=UNH|F*kMf3cuUcȉ[y{I +ƾ3M=zVX_ANvTy;=[)S΁b#Ԕ:^H_+PyUUyհ}F{^3YBd#txFv3t)(5v(X:o֣KiVo8S {?5:gٻy'mZ9!˭BAJ/;*/$ɶS`^w \!1ko-I[ӿ 6aj A`QZ}WV|}"3]XBx%, {| ld LI'"},⿊"jm>P7bz=<(3MM|/|v@IR^+md<ʜf #"dA5$Zm]rc+7ؽyhmJ{n[hceZL}jI@(R8\%8mPtu+ric(B)foz&Xx4 <މ"oz&KqpKBawT|o^ڣD¹@._D?y%c #^^ :c8e?Aff 0|b|\R j+/:!yYo,||DNQN?z`~!MkEʭ}.Q6Y;IJu3s=AinOV+[hӖb0 BBn ?d7T˘# }48}b MdZGo$$x6gb%4wWˆn@@It P+~ pKG  >~BLS@6Qo١t^[ROEOnn*񖆱(`WfHHO{)rwEj'k{c#Q Zf Azz>xb%{ ?do6J-pt%H nMݑOkѽZ^;d(g=!].(fN.$`&"6f]6}M%l6Ͱ q t23TS>Ig/%l3AQJ5?Wy 7\79~׼Rٍs;eM18ID7hS),cD2 O|hscH["h.aԂU 3oՆoӾ:$"A=Q!<5Y߱kPcjN]O#лJ C_GC,Sfbˡ1 aW:e^RUYƬEPS +>@Awt@qz|=]ķ?5fЇ-9 P'}僑khevOm5O? |6Dpp>qhMqSNgWECH6̮T /@+^snX?[cNS5߂²  <;vX ff6` @fc)]&v\隆nϼj=^/s| Ίm1 È@3vP|S1hnsr1g=55('&JRtΚ*.R6Pو<zee="8[.@||xGOj.^o?dѩk;aLSMIۋڦNRvLk)|Qir#u|GwW!&!ܾWs/b3y?Ñ80xL U|*yOٻ.I#AZ p;W$o% rҿ&*R#$zG9ř= ::|(<@0=vU0Im-xq@gcl*N}7𻳏3TY^{-+14D7/s2ot+Q1 i^az? Ltnh/iéW;O%NG𛢣Va#m2FlCc٬1lG1ں*r}':yBba'ڪ ]]5.~@T"UBM1@xqxJu8l ͲuhjƱuRoTH8Dm1=;nh=oޟM~`*3*@OؑsagpmpLAE>*%ע ?rYhͪ7W~s3aJ^wfg1/5İLP((?moׅ`9;+gt؝U%i["fuFVAu?W_J|`0N"r>-$:1qg b!bpSuKoaLm_E$$$A6PqiO".ڹĜ)06tjƺ8JA|)'JS) TxWs6}X~v[ TYJ\AVԍ2֊*R}\RSQ(ǵ pg5)]j%/sw" Gu0r:NC{: 1l,p-fQ8e^ʃ̨ʛ,oDkdnarVuc>'KX C0\ O\Z'{xϘ-^# g4g}AجH ՌVRc^ϳ|6lX3Vb Y6 ĚQ?5>!?#ԩ+{XUm{nEI=r8 @(^NV.hH)h*Z`z'E7c싡׀aP3 ӟh(!ݢlz6+/o n_jYW Q1:E6<؂5QԊ$1AfB:))Me>֜AKkDy$ 7" <Ϙ0SC»?FwHx? #g\6) M:`7?k\gs@O\Lft*ciJI|uYV#,8|R>͚\\UJL1&>V^}6d>cOgTjY +;:h*%_a'ǓCȲ˕@%YM15@&{)4xaTGhk.@que3'::JO1kR[%\M^!,mn;/-kf_@*IC;e,\d'O?h\t ]Izn54<ڨ4v(=mT]aRhNUlGrzx`0;d7>8MoW;鱉fu(XPOL4'ul6se1,^-F~oX%!:wgI()%q̽rFaA]W IR}54/G{sG>n<@Q U]b>T&&v{uߨ3W`wߓY,o #Dw25O^[#pf;2έ?OolϟRpr,6.kpEt܂/*sn~2|Ecc+&M1{QgX7{N}C!U<`|=@X IO)k%ЀL8$c{\I)%$襍(Kau%i?,ȓ@d"Xdx|0 ()DH": ,/z! ecB܈H?JEchBZ!˳gg%G΂?  a3M 8_RBh_.ajmL/s&rtè>E6?nMJRۂ;D_KYBV**,*=.Zhv@6JE'fP¦?rk~>u2q"|ke`(%XX|6˳5d?9*Ư1Fڵdi,GRr>Yvc=x %eN`kiNRz%,K>یguY/gc=!n(eIB"J/: %L@oX`;?474Xt+h\lsܖbBBxBgo۹#uyW /3ڨ~c&q/O*~[YW$&Dԟ=?mU%| Mĥ(c|8=d=%Z>UΘOm}MarY x߄>S RYMF\{: Qx'I$BWecӖHLA#svBlSqTh~S+͕HH2B{)ADѭo7\I* 6:"v ݣzV{ϱGM֏}N`~^Zr&+#'r(1)87 `@ݚ8QloT*ti} rYs j*!iLɆs)t(?A8796֖~lbL=ASww {MV468:l´bryݱN^`BtFE[ Ne`RHVIkJ(m`2fHB+NJ4mդ34dq&g }Jސj~V_AD~j;XRf:O}]nG)X]<4 #'>Yf܍o }JJ)SƆZ'g,6Md7g/]-dh@p9 -\$zHXfc=b,mi&l*]L9))!mi11[gagLxK6aYDSs~~lƿΑKHbay0xc,J7!u^O)+v],y7sb) h0=xzo1 ުO_$}- Kh=m,dAf20s;&貌cawofstp\:*_ ]D%zmL6Ɲ:cD-u$A\N릘ԓwB8nou_?Άȓש0:ɏ't6Kd [>rAG8[̈́Q7GQF9|jYQ >8i|^E[Z\>?/4*0H.DK4E5P'gE~^baT%hε$K1{RqP;'ʟ ٫ ĩ ԩÜf;(@$fC<@?}-"պBÆfWnHjByA%&|C$+]j gx[* mvt7UcV[jECwXTo?n{dĝAՉK-)ю)(=`EzL3T1 lS1dh2\F<.9"$8Euj ;"PS=VW-Wlr܂噏>,= ;Z.>œ7kQhkv6 dŠZm"+TM\:09h_@bues]8Ȍ41ÎZ;(K|:(@ j`Ky]!V'۸8Nްցh?lqhLn)~]$eم2;MOe4Ϲ$})E5F:uDz a>Ƌ TiV엓U`ebZP4d/!.tApR h(:q.8}y`ЩJ;1#F[{'@FO~YfBUNW/$BY!.l*ޯ/B& D8W2[10uiOWe\}$.m("ÇDx Ч ~kJfź{ş;'*-fm@핬qUzRI%U8 d65N*ӵs؍o}fNY4^jG(\-b^DBi QDx7y]KºY P.5 0gIMASoUXXݕ̨L nW=7gˋqLl (4D5}*<+䣠(u 2=@?r'PA{C{ R9+5\8[3|ZrX ^ƭ@ ,0(dK@E\YgnM@,,k${.X.z6 .5|LAJHe`HX?rOW8@L ,FD?ue}x񍫚s2PVr[Ҟ&a;].@~LMN+ 1BX1W=eQ/-fD`ǫ^E ìu9zͿ0eef%8ERxycLk] %Iho1AN؇p0h}"1r9)DW$uAm0Hbtk4"#uQ=3p/"ѫ;VÑ[ou 5>IJtT}g+ !ܳ&.Мy1@@c?T vx~^WaNh AtUvݵS? tTo-TR  ݞa1IuG ̾a6N)~Xo̊ϐhz@HfïiGstS+Ky/ +M/|7#ij_ɌAjZ*x*峻tbk|ŧ ^t]*hcn9:FHmg4#zZ_p  c ߜ0 a6u\FONVƯƇ,/w´:!Z<]u1!:F!U0{7Go'tn%^EKZL'tE{Sjz^TBX)O|#ڤFU >J݆tH)P7XYL\b |$8%] W)P<~lMdL%o2~OO# fxRCstVO ǟ_/;1#_;*yDBOA"fCdX=c4hGyTWmñĦ.~i(te@xDQܔ P'n$@$U4Q8k䤡or w##vҝ!C,KacP麽ro{P&ӃlFjkr;(s>@Sմo@ͲdLqSI%(]^bmŠB3 ESk*UxsJVӒֵ%~ h~rDTh}廙i3ů47j kVO8">!աS|8.hΫJ -mم@Jh?JD<۲aӈfzkB T :Fd`N4_kWb Ao 6ezj-S,w׫@ڙ ]nTYҦ {>t8] _j3^2x6ץ 5N7o0HU4y$Y?U4' -u23xmY =+V5hz~:'"sZʛ_Mlނfx gI^B%Fm} LumB,79+B ^تO)/s:ƂXΛ{C_7zH,ҸR#i/&"cSXQqﾋהc8 Qs7`@<::l"'8vMan'`ʞ-%{[KhLwVMмU/(s 8F;v]䝉^"O0m=\[ PHI7{K$pIefGhڸȪ׫IP zEB gU//v@ WnA~P@ߍ$MaNG֪Vz`+-~( s"Mⱅ/wUP/l[ٛ{LM]>>w1 \[k $1Vv[&7>){qs4% Ci!P$d:2ƜYc9XFF@EYϾy53DV#h"mu7e%L<߰ &x,1QS^t3K]Xv)*- 2 Z0鳲CT9Ruy}[l6WVn=Y"xnI7=1i %ScK)Ar&*7%Rw5'oXk G՛#>5;9H("[v-a`듗ޗ~(t]jmqY:bP-,hqO3m ~:B+e-L3&1kLu5{I2}r[q*;p'&я!C@{sԒ7׳d9P]XYDFA-57@\yd}0Vg+ϩ-%O`jQ5Tkw-S A/h\|E_v#I;' J;jj͘ 3 $,)X,;Q{FE>* i f.X1m^lo)+b2u $:UM3N3j55Pau87+Byyvs篖rauNՇЫX%:7S5kʤ"YZ^7G[CL꼜v6AFPUy:YSg})*TK*O@Y0uU.hQ\Nʺdy8^kF8_ogБR京ȏkc~# 0%(hTXqF fT# ^%YoR/pFd猇v-Dh遬X@ 8Ҝ:HH\b0 uzۀ.{&5rn m B}^V^I:}WQXaAlJ7KK&Qh[>SIJi]@lQzlcV*kA9pf_H$RAQT`RkK ̇|] ([J RF">#u&+D hx\pf'U3smMݕZ \,%_]c@\o{sKۤRCG$P ]ZS ]!aaᣙ.SP!!i/É\JYPr|pU 3MT:Qxvb~^TJ1x'D]Xyd sRgIánx]G9E>k{uÞ =3;tR=6~'FJrrNZkuf,d'Gq0Lk"[/P= ]m,jE5Y dt CXOY@]&x`kB3([JYLF4܌1⊹j`6UY_6@>I.i574sx7NAGfUJY}RUHo )=qLqp# DG(@_0q}`݌I("C)y?TiXIZeD;Õl_E5< ӆ^H ](BԪ~n݇K@mk&ݵkgMwLywaYnq&cFpΗHO5=>w\-nChc%dɀ_ Xaz7- QUR *汇e,gnjC? I/=Xۨu4SÞp(EIAE&<) s+#ha)/,ݴEvh< sĹ]r2'~7`f|%u8L$3!FR $iT1, Яf_Jh1%?W/Li3.WR-{pQ"5>#ms yd ]"7@N>6c{;_+y*.y{q^f#:._J _ ˮdGR]bˈ2UpJg%ӘvxAw,/⹔VܼEL@:b](vrvIDC$d!t(_ Cy k\ :X5~5#Thk="{䲯B<#= ك?}hEMG )KPE ")E 80=`uTIixh !ղ_Hq\sҊVgaEVȃLnOݼ艤e$3X"IP4H?h}'Ӻ$){I݇5'1Mdܶ˒\f= jqFE0V^#*R::KDi?ezo^ !ib#7 SS^sDmDjBN럄jƞ~u0hN Mݱ%Z 8pXJPA+[v/sb/;p9^]1)Xdx_>ֶ^g2YMVҝ/[noMŹ%t-GPg&BTlyZ8Dx۩[O'o%l} Ж`]AGlVN_JZ8\}r 6wP{YSE>!Қ)x`·lufjܟ:;Jg>5 Ajbm)_Pf/]1GXGH~x{ǺG>2WsLP|!̣mO I'n=c|z2f,cjG@Y[`V厴қm!u!bsKDZ E4b<0 Pl0ô] {@O.TtB}!)l٬gIY&{_igS12Ta1 u: I<]Bc31Gސ0A0:uZ2Qcx\:GR:1At<좍/(1$~ "0sA95rp%rNĴiKL5RR G[=] gY̽$ݲu};YUlݏG=NY#lc,Ĵ;u"3ߊ~_Sac?OVcx\dlOP$$iWÞbt_%^oΜCV#:'atnWR& @[qW捵ؙ/ݣ22 N hHtUFbܭb$k$9Y.;MV6ڜ !v /Ж!}Fs"qpWj;^:~T@:FJY}߈2$`1G@pfo>콳hYsur>{^S*| [jx R9َD@`)(d}K/`W!&错?l:Jcyd͢$;nePe|BnZ%c5\14s Kp}uջnڸa[&#J0y6#WTN: 9*'8Bbv52gv^{$#oD6S?U ZlhrP׻hdn:C bTؾȏ A4VXBXѫЭ\{d?:Wm2ѳR2 B$#*~~-k49Vu*%YHA@&-3:SLl'6~X+#w8\EܲuqxDasʾ4BK7}?Vϙ¦lkf73%8tE ]5 j%FUn(tgR6M".@-C5*Xa>}P*;W(~뙿ô:w#hۜ} .u_(Hc!', ##(IﵡV!][Xh;ZEyެKJx/o 5d@ IUU`g<;EGhA3j1d{wśh<]8y7T C6eU^``sPrC>y hT>J#V@_=j䩻v v̫sBtRj+U6\҆Il3$o ,o>Rn QW/MC8H A!~XǴ6'-|s'#[6YE]gТ*nW/tĿDW36KSy. ۃy|_%1\^DžrZv˃ZpA.V8f0r֧i6lU&0 v^2a6&ĕj1s=\)xA_oXuA$Huo3HP4hR{2[ }S"h텍kΎ_mFHVrQ4< I53M &⤒ ?~jϽ^T<1 fTͪq[r@W'bQDzܾ2 BuN(d%o7NMn/<앂ws{iStdoNR+A2'VtDW92 {[@CoFۏ?=?̨CfD3.A Za5/MƼW3ج,T#Qbh ġ;w=iB:QA.:hHZKgىWjHcbM^/u~bgN5)4=ma`I6,TJp6od=EGg$O h)u eC0G4_4$FI QX9 p{RcR3xIox1ܥ!aHX?}쑢hM^XPK &z5wxR'A%P>`\^"͔ PavHVgnIu7M7wdnGs5<_˲荥yRh)H,Hdِc᬴39*QSVmJ1X"kkʼn ֓Σ.FT>\!&a r (%ZH9^nn@i؆E (p9"3j\v`iR{ 4OW?N`NOg"e9UAq='|Ehmӥ"t!ez4[;htB(P F`d֞9⒙0ꈾ~G~I+ N;AC-'vN?|p֧Ec,yR~R7HY<-?Ģx|:ˠgvG'Lvjalz;٢?"f>/ͧsݮS>|~hw0;iC\szMASTW *.3^5̰YpjeQ:a%ik2X JҼXTɖ'2gRwū4\_ճ/mO_ᨩ=\jo* v$?Rv5&G=ZREa+ i Mqܽ{L$\`1pFD,>| F8("tA}F1G8o'w[S^+קc+KYNԛ=')â}vnU,/]5֢ͦ:&B2~zvARVZlC J m*;jmz?gH^;{.mB:x3(QcI - / nGt_{iwgliξbp)IAFBwGy=Di1gep;R`|{][4bl#?2Nd3ӍpG8"ѤRJݭc*k#s! sry)~J4C^q(}MfF9OBYwf5C\RaZ;.bu )^z^8\rzTȥ+BXt7cor^2V@7SIIigX !Db67,_ K]rǶOۻߣ? 1Ú<]skE " lm9 ani$x8K{7Q%0"US$,\eSH!$)@nc<-(Y&UpLPbog66\"  XYrHf9*>Iq8e4Mٔ[9 Jj+ n^c"+uUIɷ$=]nDTթ'WnODi)5v}J_γgY~@Iw oʗ}@1nA"1idE$PwKao\ˑd䌟t9)l~[`R+/}ͬg|G" }xCÃN]Eam7CqZ.~*,uӚ} |l 0G VA.A&'ݒn[}%3,DkDu/8}P=e!.վm]mUWh&~)lkošgK䊺IẠqo3pGO\Vv K`L;^@Ѓ`}tpbI3횛AY 1L&+)eVU "q>-CJ8MoˆN$&Aw>uZb4]ji`&(G Y֔0PJC8HmTu1PWL<8$2~ٳPh#Yc^A5 oQXP(e ތǕ@R2.?3 j `G8y#GhhdB8fBa<V*ϡlT/ #mzU{-~\zt3V0"[{_Jgzlmem$lZ!v>W{dLV^?nW}L$Rc)_r79BSZ1rY}LgWuN,)G]g@yxmn-_fmQ,,aR) ?6}rB!96?@T S/cs7@賈3[6Za/_PC+%/F#/_L-:In6'DCùz_!̵U O{w\N!ço,{CW_vp d,VdSc!E ϕղ1סMޢOiuCey/֩\)āUs ;;k헸/ZsEUoj;ﱠkH̠}zQ60}!E΍Λ+Ru4iNHt[OyN'#u][lO!Q~dҰCju_¦`63<λRc~&_cw H0&fm@wNvQN(6K/D 3Vo\e9+]0,v]ЈeزUսVX؜z\̣02-5ujj|5 hMri%Rg.~R,P틇 0'.3$8tF OvMqhVAXQ12M>_7!do'w1pdL5dGΟ1l !L)}; B(\Wr r';JGcR4VBTַ4<S S߂h)&n#%/%,ĹIK0RgS2l/Z 5,S 4^ z-7<]iJ.zj0-*5M(Ud<(5.~PPU5hrSw} tQ-Bc1Dpts\CyUόR \qAwY")"DR(VIכKd@d`od݀ њ$g4#F( uъW#D,[64 )*cµfQ^Iw+\u8lE"0Vh3(^?ʐe|9D'@p|\&AҸEJkBm@WF&>:Fϩ)caZkp֨z-PqĢu J]*.%tv,ߚR(ٞ<73ak47LFWG&sUYֱ<#Y8>},ѱ㩢Q/12OeeVqݾ}Cή3X@G۾P롡ۘ +H:s1)TH.4Q>yTt<> 0m@[ou)"nM>]9e-IpC^JTʬEG֠Մ?!у%UǢl| |]YbJ.6}*WY'˶Mq(ta-mo, 9x6⛄Ou`<:{ QP=mDmqW CLWu/[Mp9ڬ3ZlKLyZ%-|ܯ@}+MKZ=Lѷ!qXlA~J-*_1֟'IecTZH+e$-r/ݨ5_a<^LO.gn"Eׯ-ktBBdX*: ;D/;.oHr*?wj9"BsVʦx͜N?/wxT*C*X5Z+%Ύtx ّ ;QI:4t3Y}ii'@:2Y"+C 7s+Wy~ZI5Ձ)>)"^k\×(UGu2JBj-_(瓢h: C&.~Đ_`}spxG̥Iz.c֧(S$3u2\dKmޟsjYL=ҀhX]Vw@M 'Xi+׫xO8%6Cn*:=]9wBkq&$I$ aQ i_A)Nf/ZJ'5ܡEDb4,!+ +϶_6 %|o z|RF".+~c?iL6ٱ"*b*`&Lw1E9)T=xhA1@6*XpgkF/͈h9^i9>5R:;cj v{Da]+NajV3HӦtMyw3ZG6^7E"c`v7NY\E~$Rԗ ~|m5`IֲMu桚vkKxj3QYjB+mՂ0`GK_ķiAFXˆG/PJ"ct?O’|+D#i00x96Y|T6u 6uESizc !N#f~4, yRC8TD>qѡ0I:kHhˁ[+-$1`OK9 3b4nAc_5j"Jf C?AE<+yV8#ODź5FtYŢh;l|ҕ O9VʸVhԊ..->͛8V9uije>LYu& G+amw81,niyUZi~,'REހQDԖ-esw(R]x)<|qw!GT%X CkrQol _5@ ,t"?%uHI5mo n{8c{}:;>\ҔEj|V>չ>zѢ^1h LoJy"NʦFv aI}Z gGp=fN>QTN1Y.>7M l <.qKk:Lovy2IYg; qB_g%zGOrG4A&>Ab_]c Ԉ|GuR~['5tEM"s>ZH!?8crH8.Ժ>pхݒ?ܳPи*)"s՝h.b$UGHYj*@bϝt4ĪիViےP8o:ϧWb9, ';>5϶#SDFnZ[ϹO9wh dNG[$smG"0cǵ0c%f]7vcNR܂rU?ZK'¿~ w̏4Ƌ,=˭;S&b }+. 2 QMj4(χQ?m2wKD Q ~[ꆬz箅eؾ>' /J[1bOAG߆~30zgc[F>GYχD`f`oM7S"]-#8Ccy˦u`hi)\ hZͅv+[Ddβ%ubqZ}0Ǡb}aZ6H\UCmء4*[ձzyv[ Od zDΫUc*Co>SɋB7~[1_N:t[K5a#.T 'pHz0LZ%vf]61:RpBlڈ' 2^"d6|=K?Kv:b 㓆x"'Na\ε4m}$(h 8fXACZC߾) \+]4ϫsT0WMEQ/{zdcy8u1&Dpw=^$7{7a ̧Eqgu{15]S 耳7/fkR/6p]oF叭byW4E:`͖lzDߧaxt ܦfU^ ēi%k!O=Y]4p}]xI5pHE:~gF⣳nuJ]3 `p*%iYwU142ڴcW뾫r!T`/t4*[GOxiҦ\("zm#0NT+Or{S̳ŕ8 dr;Yrb4%yh%6^2ve=Pt2"3Z]#]?asHy8>xfm/a` x]$R":g(H&i)6dn0s\ƸzekN'UQN:YI71Wsx#V1˲ U -iP89@5Ttעv7R>JuDsO-U ~gt$|d!Hg޵l03D]Nn r*=9êR{VR) ߒg7^_+ [S{!Bk(FI ˊ(m}*1&kO÷@ A*ΰZqOY_uzC·ɈtkU^$ tIA*2hS&%N̢d TrewNbˢ CM;M*!vW$@k~d? A_P2I_8NcPEbr4Ȇp&9Bg'B؞7QҟNg Jd` 0Z]R=6"s#oNuD2ou~Z 99* }cBˆw7ݚWZz>Xǎ용68nA)=.3Jt+:TKM3.ϓY~^NQcjauowD E7.Z5hqICL̵R2AQ3vRac̐ĕɶyu;fc XPMsN<-M϶75^STːW C5+~O ~nZFY՟,ও$2gMyڔ"ٔ[5YFQ7#\IIhROoa#0@P[^ƣy;20๜2I Ҫ>$*%UEF ]7<ul]WV0݇B)+.}Ԇ&M Gy Q1W>GFOh"6E7lNU"ҴX@J nB"n]hK7!y]G z"v@]&}umݿj9_m,DS7.>^IŐWndɹG&(LJ7oZd?7ؙ*iNM|ʼ;>"=R H; =L:1@KP~̠!܉"d ]@-tεP5 T6=e}Q 2ɟІbg?V;F٠u[k4-HRgn^)_+95|}FAƖ vTl f_K{͡D%I+/q;£Fd)g)?K1daL˦+>/%$мMUƪ ġeoX/ n_l+' dg'Og+b6ҙn$ UгMxz>d1+7zfE8E zk24[d %"<6h`1HǔUOH|/JFu}*:6;\dss* [ZwRdRE]Ơ-J3N|^-yy9}JlSfjc]!cBSJLh!/=fȚ_y^Ye7aE {C˽JY?rF(\AĿ!J+ )dxZ>~5f'nv 8ߛFW[q`"]ՄY =ioDL$)ғ|Y/Ga6;߲~Tr@iF2FOڸmg[z몣 ^83|V2SdޏTiŁNW DaPCˆTB Y0eہ ,k"@3ۀPwua'Zʵ1?(#LSgZQAэev8(p$ mlm犼`h%trV$e-D m&xxqW%լez@>j )C,l3E0U8_Hi ىZmd +K/6?}!fG_ʧG9KO*@ /E Vy?G7Lޏ=[Q:;aJ-Zi,4-CnJܞGA 4PA@Q~&َ"G*lUfk9oBlT340[}1rbjVkSݨAcPmv2a <]7O LX2G)qjUx?۔{k28sQ閛dn )'pJj E ? :ut۪+B,AUCBPQDL4na-CybE)'T6;Z;6q{ɠ`8DT 鮛I|PXRɒT#V1&4$fOXnwxU-Tui pe/?1o3-ýLֹx7sEM;aBQBq*5(>(){XV!o#<4hHA[[#LUl{)S3 6|:Ʈ崲+Bx@{9._6Y::f$-"HC$QȏL4ϊQUOf R7W4oG`wQ}AZzsq6h7WcМi~#/iJUG}bA<ŹE*# JsS0WkڶQZh7UFV`afOQŖpkؘxqR]'[mVB`?囉r|%ԇGbQ8]91=.eDi}8[q*b"Bu0w{Eώ9Z! [HN%,JBC쇱KP=æL^NAR< SM 6= ㇇k`UUuG^!4O׫}Ʃcm)%)Qw6:p$-~ n)0e eR?173l&GD ͡5"uFK2BC&hK\  K #XZʥW UugjHzH܉ w-U9@-eAf2FUA9?|N55Rꡀc5w{f(B 9'w!J /Y"0QМAMdUS9m+ǿ;SfCM R*4 cxj.5dA ծp[H++T\f>%L|%)SYR2ɗ2E7ɰXﭠbyB6Op{6 [-4hة5M~W[0 TX׬hƨ,KW22toxT@^cNpn/So:#f[P4l?N]iЭa>%ʈ@p8Wn8oYi+ARvY* bm;dq֣}?BōJ2;Gyc'E=.2+.%M[ :{-MnCҵQd9 ht`}H_V57hhC  d3G*' (m&6VTd1m+\6%rv|me^P/pD,gQP+/\)shfmn ЄT,$IZ:g}@{-b/FDP2<A5yW= \AgŴ@Xҋ3U}-gA:ݰ;Lb?ҙrA>aѩKL5E `9G/eM0y.\ZDX9XEH 3J-ڛLS&A?LE]?2A RX%G?nA()DF3܇6ER?' Ci㤥Ÿp0\*#r=`}(`A_2,-~O@:Q4_@^|06W\eg@A,0Jp .+\ܣT1~ 5-&#%]nxO2|z*AAQ9]^\\<5cBx_[K$(%酏O~.ݞ_[wF,=O˕NѵZVY$MDw'nfšbZl*uőMߐ8wG=nyd&ֹtZD3zkB |$[)m-]B(TԉC|,spA|1#qϞJ9U~{[ _\yYb'y=!ت^7A-nZIFa,!w%PW$-&9qUࢳB* ?žKD95r|H1lu 2c#4ɭ询NaceR00.Et&}>H D؇o';,&2ID4M[hØ:^9aOHBd4 0)lx,sB@3ΝC%?-{[@6䭒6Zp_xJ jc6GSA_M yx5% ׃;C῱8y|4!I=ҕ `׼b ~O}Vv8!koR# ǧ+Iҵa 6ˀR))ӉcgY  ڰaB (Kxlo21M C'QϸNW?P]sDuI> L{?oѱÂ+#0?cʕMR&,ۣ6y/U)fºoIR,##~Cy+ >]c"wĆ9ո"ĞQT=uZͩ Z^==ubb#̛iڼx|^}Ep_Bp"MӈhG.aQ$b?gڜ)AfKO_mkEgY qZF[Zq+(1Ms^}(*f!{<pGbƠ@;yP섣bQ ~S76TFXHpQV ]"o͔v ' A'vY\]pΰ3(}"v؀oW GٿѼ11G◶ϒl-U4Qٳ˪ox-[F=}5KYt:QzmY ܨ;3EASW,?}7`4 yk+ 3YMteh<}A|l_Vv[ jGb~{dxq6{u0@<+lOkI#ZsI,c#yV"mK|5կEcjZW2!z\v"q9sXԼ'咪9}xڃ%h'ӎ^@2M3KrZw"|Rc'|t!ܐP'֙m|a|b$0o$tJr N1Q^5,LMIާlOrmsxDis`Gq\lwT Nқj8ְzS7x6 s p%{ =]00)Ɍ;jJ^UFa6!?iH˯{ݴm}RF8qkӻnҷ.Ω{, -E Fnw/O:C2[_7SVf7lA%oSWg˥'%j׳-")?1y^Ȧk !`o>-(*ArwH1ރGs>; s%=杻YcҀcBu_ʭII Vڄ XHDt7 "Wb17!wB!qjOjKY쵑䌱Xht#8rs0Kw5 A$>ԎaGIڃ@HYmT;aH1 ~C MMuMBβ9xr;O-ћO4u\$FhvHۜ ZvU;Zl0`騐1 㝧A \-mMsy\Tl& F'®Wƍ5P] )ΐ/(;DO Bǟ\*kfto2\7 v/Ihmk@ia^_q4*{&hV`WjQblj9~޽os}Df8ck`/A#`H Je!Q0}Rd=«H[ @@ނ&W&S|,*uwF98P3#[Pyie:kv9@~fE!sۀE؎W/m#|O-V(mgN0J;v8#jn &mKNeTJљB`DeBmfy lh\] ,P.<FiX 8SҖ̳R/0e<&L0%H1TR 5P|O;su{gGYά{sg7]cY/ i;"pR3or9JcvuǹZnۦXm|[b~b:ɦO l/H[i"}3RsEyv|`.A.hY.j<8,\+˗q%I)Un ϝCd1{=v|Tv<ΑT1v >?pTkƍqVK{T۪; O6 >[ b=KMS_(2a*%C*‮511~M"<8񫆺M2֢T\/){F_+X0NYI$ٸ6YaFY$ R4ZԜgmM\֦NaHY~_߽s$h 74HFpo8Z3{-a$ \F$In*?gHYX5IߑI1nbOK²AHj52`g3WUԐK[*K wBsKWu3rpp;[Q,"Q*3hP^ c7ߤqZS$Ĝ"6E+(`M\E=&$p;Qy9O̡ +_iR@ݼ)ta@-EJM,܋ƒg5RhQ:C¾DI+qsJ~vi^-wP@aS5+1jo@-!(Zc!39nGn? C `9KzѨfgK:ËUmۢ4=Urnmw1?]a4:#aspvrqv 6S@h.|cʧƃQ@>5SK1%,eюmBb`<@eCJ-KrY4@!%eЇ_+1-36bݕlpĹCJ^r~\wʗ$0֜{hCE3Q18ΨOڶ&J~PoR|3#UFbOji'DɖEȝW˳aUuرc 1_ޠ-;?"X7ZJ;yqw3$~<˳{M -buNlFXUB/X6⎦zl&>z_ ҕ3Ȧ; )=iYeh4<­:߻H1 iSo?~ή!|:9o,ҝ}~n)\T ZUMaEtƏ{ebYtJ٢xcWČ9:@d{ u+S8,1=GHXH<^)9uY>x$.7xZKRǺd8 ^f7y=I*BCTܮ,@4n@ykQՐvN\nSϪ`6h;Vm`YmފlYDX FH 5gL9żw ; M0/eu?q Vo+l߷8IWJQ6 ʗ"\k.Z! EDx%>f $ E۟9 bN(RPUjbe&\(!yTT[J_&GEfBfzm inšQ/u\*`0>cqBhi$EyG?7HuSKfhtؑ7r+8%R c^G߻3˄B [^"Op |M ?&5g{ȱ@qN ?\c6vDjc?<-|^(iX"O'a:qYk"ɛH?,)ohʶ1m^r]hԋ+eV F.NB}v*2)ů`3u9PfQ e<>3*Y_TN2 VPY:`^6͠@s+3H3*$GvEʣvf)v!gi3[ۄG\N2 VPD̳0oD-_W9b,3eEc>93#5fၞďԟvk2"- s5fbWnu6\wDPS7W#7;u}_3~9k$(5T[S^>RnY&$& G6 0\k' r!TaCXPc˱*^oϴ9 A:cbfE ?<{f^Ա {?45YԂG!of[ ef9 s[)mͨQkENulQwQbmd`OstKK.Eu(1"#?aؑ%0Ji3zD`.\&€n!EIANmkHe,VRiܯ5 7 D}$X g/r^h,oߒwڧk$Ei{u[0 JL@~E~oyTd4EC^"L{|/$G6;ToP)hV^l\D%4 ,^wwwv IH Yr:5P^VZtD 7?NmLQ Lw-݅,yS^MG[jDOJ3)[lGh.}Np莓 ^2=&13 m]\)[~r!K<3Z{:c3љ̦ mo_RUcHPN.^Yi X|ԧDIK荨W"cEďa3jU%מǎ yxrL4@yR~0?".[ɰt}A^ySכPD}-V,Vm6jddo +ȏ$wx&wN{~o_ލߖͼ&B{ k;eAXcu_lB\ ֻXVidz]g} )d1C:ZX_Ngy9ߤPG|$bn|UR}7 pԴ4fc3Si3b}SkOb!U$( l6<][2|dk zt6KRѥw<)& hB/b03>*o~Rs-; vd 8bF}vO"6*gHlPԘ>d,%'DkQZaFro|P_ZW(SʕGTpZӓJ+ = K&:_ )B:[9O#[lz UWM۝$UmdԵ”W)ooB2)M w6>vE:F #gEQi@BtI!A_H&Ø]HA "i7UCS\'(*A'T~rve`ʶUۉ!;|=V ,wMӮ X{ۡ"A6,3i8/[\06"19/IN6WU1޶wg0H^ju[l+C9KV`b:rc`I|D֦)?DϣA5Uᆙ.dS~e"wQ3\DG=WZ<-Ȓe2hNaZٸ2` A/d1\l^C"J綈[@35vqXՓM H~PLe ;>%jTCnq F&%mX U!Dl6j 1!2 $ȗ/J@{,/aad4d?,66U-VOͻ8 Yi#IƌԵCS +di]Y,$tP$QWIrK \ 5U[CJ)Lb,TL?O[Bº>*t(XB,g8UTT͒_N{))YNIBYډʶbRQ~b_xd[b95wz=[+BvRk3~krSo+(e .MqBul%W{|d:,b×(S&C ~F/c6eտNl`Di0 =viI-J5CQ7-M)z>*@tœ[V' -S*ڈ{'RV>oCԸ'#!cʻ믤#קI"_ 9:@ގvnFWR3 l{׹f Y+!{Rv VTrҕ~?\Ʀ+P|mtTp,-jwl*4%!Jyý"Eqxsm ;`CU?tkM`Ԉs+δ!/8وȸV0]<١)?:IrWLkǭ#CM^Y`1{NK! rԁ@+iX*HRJ_; ,U fƯ?&j Iʢl%.;O1waiEdIPٳ S!lH]sZZBOAc?q;^[)IO+ @kfEcڤU c9#4KA0i~: 4{GUh7d<ĜJl=$;:ɤޒ kBǰe:+iJg7jm("Xf3 ! -d͍/Tv,GH˷V  vn8Sy'7Mi%xQp?V?=l]ڐ:Q:&-J@:3+tteߋQ6s FQnA<K) QqGm'<)0 4ȳœOzRޚΝ"ʉyJ[o؁ o`hz$>"?buܽDL`{C44o]a C:M&S\ [_ޡaQ~ 8 Iћ b7tۙemd#fXe)HNj!5$ EzW++&9T*31&4J|O6rqZ0_P _A:`|W0ҁ@hLڍbvcMvF2r@&{ϟjs d7GMx J(1f!:lvkw"|L9УrVUx1BD~:J$M7E|81%خ S`"|qp|‚&>x$wVg@~G2ىz63; .6&Nd]jGM>Ttdu"Vs++7n:)O z#&M95Ie!9>R/CPσD5*t7&4+Ѥ X,Dl1Htg!4_ySuNj fK+ 8B?YvOmSzMrՖzX IQ3'17v7⊄\|,n.5H$=@"kDu_~ˊ,O(&8!^q{ǏlM(rE9\ur~ 6Ƥ%y2gC_(P_t\Mwݐ v2X 3σݫ?(8~A7KM1wR43A{/pg~=T!='_J^`AQLJfg ȴW4KH; *"޲nX9++1Q6ys~ŦH\ U-X<"u{l?)6pX>wp^/jmǰZSW\I1fW+cGƒLe';N3åXu\mPZD6[d/4`DcXZOZ4> I!M=ݹ$-C9=j)BGvQk3 '-jɿbdCSiɍg'*,h(k~0ȇh 61;E $XzޢBwYor=, Iǎ0SW Fv[?Bw ej@5 E]\W }s‰9c6BxRS;y)U?\6}Ŷ7рÎ! "~,&HL{N`=\[6׵[ Jkէ'߮ P|5=C{¸ i-GlN ƃ MRQ~atxW~RL1 mSaIetpo[ I}8qxB3kRj_/EŒ+qAWEaS6+u ጖Pa6Qɐ+uF*.HK6r{Y% oFz5P+hK<(Az5HG0S06 -Uv0u"8NjI3̿^]KLך%}r'hq̂>A={}975^Cv$BZ9±jBdkϹ'I${$ 'j, +_>2LlkU -MoX/|!O`E?OċdTg}!xuw6G;Cð78؅L!f,}* lT[1ʎfO0yܣJ,^ޯ,ŤKII{cTΓh4. {?UKx-D{AnJc36:_vS0Y\kwivnXAf)F+St憠O\/r;NYjaG+]BZ_ϴhI{9㔟 Ũ`fK3_:aa 7cxߗ-uug斷] Ӯ$ߵ,Z@qTHDzLJ1f،x gᙗNp$ ~Zb2 LH@\{@)pA\XMg%2?,9_rs itd eBk+/9̙T /MSY<;ǢU(@:`9@hgArEwzlk8]/emV h/02\r,|#T%A`cmdzlaͣHbQ/7!O@P1 @7OUc,yy֥Y9~rW&X <M54GZ:Q`"E֡qvL6H)vep*?u";ټzzH:`w-*QC=Cl/V 2&9B퀸nqpĩN*=1$MZ )78&E,DtB!@Aݜ\lw,!,F`c4ZXe,5.tJ0 O+ӧ=.F6*4-.d L nY/ӫ)$mbq#lE/39VڼEw5=,ɜ<1_r(6m#zTI;0Uʜ)/Іc-IFL1[[.jMhO55Mtg 4 YR,D"{|> ËsYH"}U%r8X$]C+Ա%X`!%5+pKbJN/#FgU9ESA{8çK<Ap~BJFx^3gp\o=c"｟|I'e [DެStBJj=LwwKޜs%9f[h]>+.4K"d}{΍g\%L,`|<: Y"}eAfXQN#³n\0GDMa,:nFqG?/g%<4Y KAMHx0КIj_eJ/^ 2ja*7|XzGڪjJG wUlF(.+`MD &L?y t/X-V$ 3mNdҤzئ(XLFfjUg4ފ.G8_&db8ob`k %t8ǐH:f¥Ѭ5I]:6w}!{qj̓H)[o(n Pj>#mLXLȃI! WQ"r \1i֠*h{֭7]1go"MëM"κ,)t וr4C9We* =a|ˡv-e[<ѐt0,8<EyMyH题4߰)`7 1;$Mâ>% l>!O?nߊSwkMB5Ja}q VLf G2@4V0Vո2j4e8mHc8([d@":ϊ{f]$6Iǝ${t*2 0|ZAS]KlvfνT5w3\YJGy9Ȉּ}h~u<@{!O2Clf+hu-Kքqǖ!;nCؼVrŪ1 4d&=oIyncT!) $LpM!QEu ťq#JĠzbV K|=D{uC2pRXmR^@j_mdac=l-t hZ|xӘ>D9c*G=kt{l;=bgVdTD:;6,M JZz,R5ZР wsuf I).PtS|"Bx~MW*W/rN,#29 .ڢްF'W.Ŷզ"ZLt~+;~lyp)?tU?EVz*,jR1Tm1rE`+ (d xYN_ue٫{`` A `+Պ)PںZVվ0!]1vX0ɦ B=^.I dW_J5CCSMޠD͂j]3Y@ifPf_C=U :z݋mš><;%tw1{>v^幌V5A "<yl+F m;3uA.cZs8l{2Ah4!F@Sս?7qɘѦTT$=VHFʘoOfWb1H`,e ?rg*'LmXƘC.BȢzh8y%X1([iՓNWk NASmTUt͖ze|~ ]PgF,oKϞqA,<7Fs#vnލ cȰ,["fC c}(SRwWvtSY—V*Y+*2b0& 3[] կBTS͑e?MydIU]1F|In {jf}G>Df4|'G_ɕEy×ę⦠6͠Q\WY<3wPIJ.NndDEVX8P1 ;NXڗU }`% x*q7 #G^zh;1R0H"T@|$^V3nMl2FuKGT%aڿxW^D2c>[v KHO <|x=L VI.+\# \ƅcRKsS= g\ҥ ƻs;}j)AtuX~F#h\r9p8j UO=46Nl#0{xq߼=}q[ i i(iVE2!qͽNN#_Y8K3F`m0BlwS%շߩ0Z8ֶ\R)h'P_kJJ*u/hSf:4O]Oq/Og8lY![.=LG Y(ܡޕQM1uaߘTǼxtӁX)"*Qk eB]GSZOehG{f\L~=%l~ +f \#xjL\׎1wb+\!/k$l(Mi޳澷NWh_O_~YeԏábFڣq[,vb?)IX5fWU8W 1JQOe\F6GDGA!q%0c$cǥٮ:LXeKY$Ԓw޾Um|I8¤R12\ӻ=J%51 pe?P@9==TY b.PG1ZKdz&?E迦xKd/m-զEKE#imiVy\ipA:OƬFtfP+័VvOV=j;7%vk.@+gX{?g ah9T 'ojs^|{_ ,I П19p@X'yk#9|7uW=<p7ͩ%l` Gڗ&]˨׽d^ê,cz>ߓX=-E\˿l`n'A/JbdrPjFVݳߗmɪB1Z g BO (\F%fn2 vH!1&/3qsn¶pMdlW(Nt%,5Nd 7)#Z$K=z;*=ö* R4 .C C\;0i7G Mu%l em`qo ̩cבVGUIVaǟ,=}|TƭE[=S?!mq\9S"QbcђHmښ/ <=S;glHq: `ơx Z[!/?>An'ez$u>&O m`LVi?Cbw%PsGag@djfZS7#pE`,ͯXqS9VF~XpRZn{KV6|&Ę7PwҬ )̷nLđ4̠S8@V @6Jj1#N zQ\hO.>*aO桉VVeyx5sh /'%k!mY3beVѻ1^VCp?%Lfަϸa- C.s$(wʙ\1eŠJxco N,}\*"#:ٷ@fMqKwMM]4&yҨsH7_nSƑ, \rl]̧*LT=•ҞSt-sN+.%2ݚɠ UVcHp7%#h+Mloj C/僿S3Jn H-etKz(j^#%"/h'^~4z'I{򼺣BTCt R\$jIN-$`e1ш,%( Flt`cӝ(aԮZ]C.I9e3(Lic͟<愭]M!}9o?%s{o\o`&Rt|{ݺ+3 - ugu4wN5_B|noVO%N`'Ҵ\`IKCQ vsrh6 VJ! &tedZS;b$]߂^pip=1ȣF'5&)ugsB5J7"2F0S[Yk#`d/:6Ef7r#ntSg3vCsL/C3relz-6T1(|fnW\ מ(l kI|nit+g`%6A}Na(&S{;_(:{Etb2s'z.ɐlDbf96zKr_}@$okƣQ8|~f{q3̂3<3,30jY|)Cq6PZўv1tzut6Sš4GPl?Q@XQ>F ^r2 CQev$aNڱZx-J8M/K?<|&F_$N@/BX>Nc=pAJ/$ xsl0ϚoybBCC=Q2_x9 @cŕ7 vo>eoxk˾c  '7s0Hl`2YpoG#lҚDeEt ®;I \;5m6{qeP_v3f*VDXE{4HQfL8j!9 (˄mAJ%kjaLjު#x]*wwh_H2,V(Go0U&N[n-$nL\SɗmRd҅YX Ask:ll [(_ٺ6NMpzЀ,).C2>Xs۴}Ǡ*l(EXoT%I'RIw̧ߴ,c\NU`gOeW|ch1Ly `i%˽C9hP/o_8u OVH>VaPTc{©CĂ& yY9ّH::^𜋏`Wmda<MlhxbUь kukB/K7t6ax8 ՠfe82(ָ^ىs 䍩.9_Y>cBՕ_RpN{}ӏe4tGڽ-юh"N6 :i?y "$1:/LD#>?;fT2EF^ ^"A>*={Jww!*qifIӊv/>ߪ;@{ Jzܔ:-ks25AJ+i*Bp'i{gT`JNj4]7)ut< 'i- рEvY4Ź|A$ue0!$m^,*'gkfi'/L@n;_H~aEl1sBo#=>u2gwx c06l޹JZY2W}iJG-7}yaL&qU<A/YN?@2X@M}V(Ty#eԓS|TTSVt F/nMA\RRlCB&v[|Y CEv]1!+53Ood $d139^c[:|5Ѧ{*3iEo? Y&':?GARPxNr,{pVmG(g99SY2CHX0x@ZSܸZL sG@.6QEp#Jqg,`SV^jvܦͰ ݉lKl6>tR O''٪9>S-wvW_qMk'u׹DMXL(pDs8Ԓ!B Lm7#צY* y4Uo״ }1ψԈY5p {н;^ r볦<`K4Sq]>\aZ! -hI/=tƵː@7Gq7~>'ggRAct7@?#:Ù瓡*齄)xmZo6D,NnAfg^[2utUM԰RV)u\Czn"X$Fi.1,;'p;¡:V Yt,,ۺ2'x낟}t Z:W$0Rv~ a+0plouK_%Uwsyٽpr1"u* y(KFn9qYo-|+4*,aNQc [[@r퓳FLf]9ȴI#3)$GHQ[΁Nm\~Zs JH8IPwxSy5➱`>myGJl{|zes>/¬x4eŅ.~t7nfäHm.?fJg{{CDE vKF/yk,R~ S%l߈bch}ą-Iq4niWjl~8-zYۓ|?=뭯r 1r q3qh+y= bhyJtGaE5ʕr0Ȳ76>Y04\Ty댴T.hD'qRW}UVpdAYD:+ruH Y=i4c`|y %Mڿ4r7YL-L## LI|) IQ!󛙬0̉% Fz H[4 ｫ>Sy@!5̢bn@\s&ro4MzI]9j^/HPHq_f)";gIw*L4ycmDoO] Q2ު@=È2Hvn\hVovf1h3wƺ(k@O4VRk>]JDYjHOPU."$8QH̳lY߆͹ q1ݡ =GPaX X̼6R':{!Z |L0jvU|Ke5fp%E<lj8r$\3{L#FQcؘ uٜG2_f2[?2hUSDgW r;IżUQlmD%L?7:LgmQ(o~ jPHM3.-1-9V LӻQ?՝EJnj~eFÊЉzG{{*ե6sM8M-pֈAJ{GAAWLhgM?V$-" y%ݫ]3݆QU@񿝳lN{n8NanQ j$wx+1ivix }̀h%=fz+C'+i|Xb-ը Ms\$[Cʛ7x- oqJyD)HG *&G"r[SRI>6ѧe+[/Em9Z?΅b{cM6B!R_ 7؄EM~'loI?0 ayPgpw`Z\r*bSJw߂gGRMp'ViȒӁ-q:7t3.%kY9h!#_a%ˣ|f?#mfLJv]IjEt^# ُ8gMDC%^죎]1vͤ+W՚'"FЂC*\TS[7+ &Nm*3_+-EjK X}FA݊J3)oʁMD m'5ygr䨅)R]syyF:'.moՁgL{ ;6k ^~۳0 (ܽ,jn*K"'@poNd]ڊU$۷HgM 2-(A817!YR$SESXM :;DK ջ؟lϢk?B$_CЩG!I5B\c4NZl1$3> L~#st}Q`NuYegt5j:XR=cݣ6=E;fr I$F"aKkEd C>  m.3Pꨐ*^d &?23݈Z?0 sjp1߬(S3U_?q[pԫWeY nx&9 Rf:`&)LOxQգ`3d|S+sPl#O@k=e?3T^yjaB>}p@cuja-Gs xT]BJ*\ ƀ3m*(1^-OЬe*7O {zՔ{cn%`)JBWcJO H8sfխRmzк3J"˅4I4T!Iv3 èBZ6*SDQ ȾvZ({n#r%90P\8 #C,0'ciSY@'oVc|73.EhLKx\4)cp#;YpV=xcT GAsB.L@! n13%LM^,M8>a HKsyMϷ/=n;#Ky'ZFe.:0 _@3ſ1i \Hsv):uA|7 *4ű2f&eQӄ S{"_^EÕ^-(MATB<ʌRo-qުGŭ^}е O3Whk 0ܑ]蝧2g <կaN2nu7cZ!BC=!֢T>vy2;0BʺÆA\^_Vʃb$FzޮN`'%V^<[3LĂSڐ M`|g5ZI$W|ji>sHܮ^1d?ս<"*k)ko7,6 ݯw,{S'jZVeFJ (yTe㌋q2Zo3ԧڃ e!fн0%Ќ;MinnV^̖T);dݞ{J i"j>*jc7ѨWcvD.RSP\yvdp;F0̃FbD10x\fxB"q~,@)v {$mxߡ. ?q4h̽ ifqtNIڜi-RZU/Ԛwgr/BcLmU:д(M-ёQ\\oA^ņgvA8Ӄa?ɗ|u T>}H( YU-!0#OVo,/УȢNzHM؉ǵ@}d_'i#n6<\L-LZ <߅g%4TleW,3 h?[Π{8 kd``x,!FI[E '>F6qֿ GjEhb?sHeC:7z%Qw.J_]O(P ZJc:G3yN.#rf$_WgEkk0#֚aجx2@e-%e%BƢuYz/M!8b'P@ytǺ)-#T7mk}oCu}Q0m2?vMAU 8C9L*.׎%]e`wH[@`\Rb.rTQ-* #񉭠VqCqڅ4X@@[#!N.Fd;{ m-8]1fB3W;0mfSUv[˜ ȉGFYSv|l6Ǔ@%ʄwS5,+PFA5R YhElqKBuhD#]X% ~<_"2y;rA6n}[gnu0Q 20?)]/)SPQ{d2[i651 8<-~!L˓4ӞvK-e,Zˑ$s'v/\)Zޫj$g 8dFA5/ 54"2+WI/(ced<=n7LߺaQo[ ':1=XMԝ.J|ގRV*e4ývv!Tj)_uxʆbsmХ-~߅n^9})u@t8P2@vƤVP$inAłNZr?{X0o7''S5`ἒ;2Rڢ#AE~{ss5djAhWo[AjPo^HxW;vǭrtC0~ҺE&VTrnyԥ9 N#ꊨݖb& r <ɴPw}-nayQx~ ^}b Tl–GDFMrut9_#ѤR[K-ouiڠQy2ZǑs*EѝD5JΎr,7 ^_8šJׄ&K@i+cy&v׻q:B_džƳ u]Fط'|CD,RfCXXmg X^ƫCTٌF|1Js wHFKY(eu%A%BBSCk.џ9V4^0Y h +P)C+`x+ob@O/K+8|0o]tkzE Fn@rY*ËIp usLKtLTB/b#fޖ9 *qc3jEp!$ƯB5 lgMue(Sҧg#߿xꏊsFN̗݀mA={ yr';ÏbbǧzUUbL˼+ٵH #BD[, + +0TG ZlHVhM=^"8m4P>=uZOIQE8}hd"-Ie.E:n>*fo` --ԗyR*)0HЉ {5r=s?>/QqwdozfXX~*O2c 8-kҰJp)3trĿRVhS{{L v[F cqDsz~3]# BvIثB V>aXd)_!^3}x,$Ӡ*`8mߺLk+\%RqOQ诋XD^M?0P)6B}7_gWwպo"ϕ Guٲ5XFL_1Vq ..X5S%a6` ]%8b1D|怲8O|Sd*httHcbF9#a|HQ1-(å49[ѓeLv+OH] E4+e/2_; uXzE08YJ26 ғc|00]CR M/`~ze6+IBVTRR6z[~U~V`Sј,8کVt( Tj ICeD.?gLj=V}8"/l <ھ@ s]m6I_0)K":Lt/:@$a*ĕ $c~92F<c D^*g:c|٫oȈ\\Aqohr]#Yʾ`{Q_ByauL5{v&y7͚ܞ磗ΦI>H1 knĖ+;܆=,ʒN{À'E.&hbFH0T&Ԃe K51^~γ4?VM1GtCP8G'RA֮!t{ sn_yK7_OІZMA1H".agx5Hd]F,ZyN .*ds%Na`;hJ| 'Z&s 4ъޅrQOX9>S`cu:>3Qc>j"z%򋵞_QˡEQO {$I}XΫh rZED0ވfN915"zpMnp@9QoȔH1#Y,\n\xJ0AZ3PW幎h1т"`3 !oK_S6NG qJY\E 3acS`}EV<1gSp3j;gC~̿do5ADT27{|qOUJA).dl-)4 ] nfk,$ə|є<$$5ˡ;CXp|zSV0$U0_ rdhq."NA-+M5H 2?Xf": ^m^_0s;M%aS̺b e p.|ϕTL;УRs+Vr )׃_Q`3O6N[yg„_ s\*-rCĞB#c## (i²*?SV5k(0ǃL@<&L<Ӎ_-iՁ?X+צ_]{;"4$Ta}y܊ڇE幪:=qAƢZ#K]NS_x)1 Q Q^(3?I ƃc=|kOO5K) <֜qh{`cVmzSYU*. b˰ŷ7Xh+xCꊶB3f5:P-/\5q̢v~0YY>j؎c H5X2).bX6Zw&!T盵)'zxA)_gš($뷐gƎz굀Cg0W3g2)4X$ cV-zANZ3+gb|bKfYc偳6:P]2`E])>m':OI1KMGO5@HZr"Kn &"%$xѺ&[h /<P_Ky5݅r XUKKwѮaUiR`ڱ.y"BbWѦ%)A3j*k90a Hu7"A!y pI0ZqWr_M}=&՝!gyLy9 )P ^%;B9R%d= _i)L#> ysSRJm(7~ )M f$|E,y?ġhiyq;L3aUILLef X^6"_k`0%R8x 9xV-NS?hV(ihAml8@Gc~h?mIcc0Ldh&ԷH6i6W5҃Wphoҙ-gU;)ã[ >zGC<9yAF~PsԽqnGȩQ<MjJrizfuxri_> dCo]jxHru;lH{4IՊWΘ}Bӻ%&"`{eaԐXG j k۔@ӉȅH.Opcx?zxu18Ckk~,Y;~Yjb1 Oy΅"zC5A(7/dl#fI۪er(Oi2҉P<h*E/j.B*4㩘KP97 _;^a̸ m3H9_(#6ZZƝ.w6\"s.Դ: Uz7b[/S "hEmsec©a44E*\U (K;\3/Cbvb-lX̽Jĉ;} TTs|wt,n*n!@ۈP)t'|Gs6ic)yh?Z b>8I kMCSw{NMsl:*h_.-⥸O(߷sORsTy߮TJ zdbLV@;W&WC=yMEpM0?]34Dg:0ɚ. %& [6hY[QP[^"=%z27зvsߒx)&xHXcYr,ŵѧ{St.IT&6Ȉ+tʄl `yP 13B:$0kpT+ϖbKt]Vs7~n5Rr^]ư ?Dz_zE]a4Rn~/WH.c~BLMKlYZ&&KeZ c*hC653p .(E+f i*1KxnApg)jTߐO2xJV #򋺀<[J™ he %(bn v%zb/!PB<;h5}d퍣RqzFU<9y"TIƼ ^h(r#w :/YUp_G+T% N4;,P~x%c0ղOG5mϸ|΁;W-`,?`YG(&UyWj+W(xS/6Uԯ͝ K 6 Y~mU}wqYKצE3E9r i@3<2rx)!4>vO[+;l]k9B$(d'޺A> ؜VqA<(!n =@7|P4$!9豎i9mBb76&5yաB&!zڙ nNY͊Jux$GYyG\7hBNW;y(_Aoku/:+rQ&ހU֐'|/Yҿj:ܵ }/ 5MkV'=}r2:tn]]ޏ4yx2 -M348ұ])֙T<6!K8+` 5i=؊'6jՇgP|RŰ+tOe}KOe8H>^1E| 2ue^Wk~ th9)i6:fA)|YB: F-l7<TrqV X*BDvW&JWVj 4.3~5E+?*?dz+' RAԑuaν!.ʡˋ5 z? Au嫯~Qgi*1r =8DqW'=CE\M&[`B .^*6ld]_^N)$x>0"i.7vy`$D}WdlLFo5Ժ`$QG'et_(wҷZ*FRzc$$B!h Ttg|#O*Av7EH)9ND#;}n&4ztPfjYʀ:U/Ɨ:yȷXuYRc#k5ԁW (~=2Kj\{r$a= Hlz9`,[uY'bکj%x7˭]N%)pBd7Oʯ'`g|k |ʆ])<' ՒNϔ.$ Wpe׹ mysAel VGO;%5g˫ÕHX-xi)8vP߳7W7 |(ɩ$_`7!x+"greNY_*K6;wIv1ey_FȚ3[,(W*V:f=/n;i.{$9B{h+-x IpE7dS ڟq`Ik L0:6:/9}G1g-xU<wRX3{QYGgI*%w+>O2 KVr!U(.. .!V:<92sNm 3. g!HI8[la7[fɔyƩ+l9 V;^-)ȓ2t~Y;`Ea/DO#(.J No6?2+wR ],=/T]V*kywF(}d(?e oG&]\fA:>~zi,ܧ]J}3=]WUuJ$ %W Rर^(=&#E9 g8H¯ ڵ\j.ˠyK?Rt`QD~T Q8MOO\װA5g{`(Od`sZ|;#)W30|JK$%Vn`JV"v0 Hf%&"Ӟ}dYƍKy~-4n}BKF!ăC| $RŃmmoHL!)j'JlÃ^ \s\4DVЉF.tޢպb6u]:Lڢ>| n'q~{QkEWh r)#I@]o. m \nOYM|lЛwqӟ*^~#-KK_MZt{3KBL_?dJ>1 1X:iruxBElr*+apW}qvS"M_mg#Jf>IHp90LAx@GK*QlQGUqE%}T缾{ |d@ެmv$ sj]i^^ "@H31}޿ @̐UI<̞4!!4}9XYct0[6\!ayY&*SC_09fe9^vq(\(%t|GCq@$zoՕ4gԏODqQ5ہYD Q\/:.;UR,C ߏ'9;x$Ln/Z^P@e=C EAV᣹mF-%'xŻV F{e\'kɏPu؄M bq#lUTC"UZ"eN&6ǽigy[)޵.kJE\0E{~++}oO4s^& eM]w%(/#Pcic;Q̇7_Z)vQ}mDˎj$ /\\Y 4;Pۈ?7WM@,F޵Y:)5V^龂=>+X579MBvpz߮R\S<&B):J45ϜstI-fqtUniA E`0u!Rǡ{[\eэzkQ286 Rpbp|7En]w>Dʔ`RpI8_&b>4_f欕,7D/^[9iȻ);qtᡰ̉]J3,ȮKr >@>Tֆ-S&qkheKedm BԦ-|pdAk;F0.'(O\ʴ܍r2L̼_SI,(q$ѥi>6G^=5 hӞh)ϨKƒ-{]t%h;(Y&>;2 daom0Zqv{S3GIjۖ }D\ֱCEkHs2b [~9-Z.5j`QI0}eAßc~jnlBr|:%Pabozm t~ᓎ7yMtNbl$BFXCK3!G T3?M ͋`]uF[W[~DE]@.NFo ۆ,eLuK_SI ?~vTc̓;lTvz{~c۪Q {iXDN tErj?B Z ~,Vlƾ3dM* F6~Jmf)VM or(fSl"k)kx}N#y"/itsu: ^I-'CʂۏAV8H;:\.|XkMkks6x,QAS3c]M`;]픚`EȂ?k4fWa?|)U,ZX,FL_vR$]wf-щ0ҽ-䰏b&AZ5Lcn%_2[ReFB޸_M\3z\FB4 =U0_s>S Tt@/@SSЧt/gGk4P<0:,h;rv]^\[;AK$O]ZoʘIyx8bkOu^FHN&)S'-2R2βO04QڤfV}9Xy"`k}5 7GuA!xPWPNwLC(<ךR7F?eD\Uh.VFԻŹR2&%$?b R>y}l[*8+G[x.E]hu>jMay4̱7s9SmQśFNzsr"2_͟"sOs/Xf Z?6J``_? P)Uq\7o?ٳ.aE;ԑlmzZ\eXɭDCt įT5%uAhv*D|(zpvN,l6ǘx]`a#]ڕ$MH;9m|tx]msqPG2s-LKsa\ 1\l3z'?sblLO5Mt*KRE0݃sD8oF6pC01uz>?|]a )9-cyz [w-\[̨w<(C##!$M!wr,aәP N"?>sI>}]3ND4M&9|qud g|MRkq Bx7lxE+5Aqg%9ǯ"\A$ ]N$%^[|Lt턋HjcP(Bm^ )DCKnuBeq3fmGOd7ry &dww!xaAc~C)5_!ާGlP_$Qԝ.jhW{4!?jz$+&j$GLNgѺ /l]|#"cZ0F`t8Y-ib<[k! GʭqgY\EER126/l1ilx)qpªtmwE5i9nV\Z -]A^nXn@N]$ttҙ3et.l[p%& FW9u#n@z탠K/,53'􍯁C(|ރm0 t&}n. I.O}j}c h8 -uV]fvatwk$0;ϊ/'iYP5fl 95t}#~|12,rױ(:g%-—v-b ,9ׁ ;$[nLѲի,XS o#`s.R.K:>'BWSp5v^w7 JIB!a@(uMO{P0|+ŝԗ;FY*Ϯ0*={5YDE5M =B&:ќDs$Mu3=1)4z6šy%$vD WaM_[qbMH/Je7!qY9q7mu!@_LGɍ~@ ._8r}ܛ~8E{y1dmޏ%(\lA[Z>&< oϧ+gq%ǡ,hSJ[~k6_C8]lP.~vW %x U])o;n"s9/ѹdf[,t^?L[R7l!]fH:з׺O6#~pq:7XkhmeʎW2oyҴA2R|C؍&Qz㜢s4b}hXNigwL5'㶁\&]*U}-o6BF۸u\ݝ! 9 V[Px= : l7n{vj[#1$WC깪[߀D(XvHDP*074*=y7[Ayfa@iO=DgXoG'/j7 _& N<lT+FXLmk#O\[ g v uhIġNuߙq^h$WC d/_L 3p*Kf #LOzyX6JNQ9F=.?5E~)em$sLUS L`~3zh'Ȼr_jt$$Z@*d¡\^ȼ pl\V;hWeN =H;iάf;ZR7+΄3g0E܍trqô*-cіLZU`֙DBJTGij:9BE hI Ұ^ R K-[6rwxQIu:YSyȒٸf(hKT`jūф|ZݼQпMO Tk7&cem͇y3K2oT r :٢Xq~UQB>T}tTXpd,C\*<ȶ*1 :I۴ji(.B­cߣvz#H|iؙ\LP#\НX9FЦJ\qv!zf1 t/f_v=:iNX'9~Ejև Xځ^=(w 3운(sTT[lt Z''@h-d8 F5OpI7`u pF"WcPumH=1 IP^ O@,9l)qRg'RB)L:,sW-MB7͔qLm@;":;apC YmRgA' k*G3iB87zs&J/ p`B * %Gˋ%Eexj-H+}~J0j(EV*pf4~3n!^|O(.ek qwigzT!:gֿ[k$՞C;u;.x{sN"BEYPR7w̘[6%@YbKbGh* _zEfӮ\+ȶb~Ny8Ehɾlb LqS3ܖ:s>ãGӏLޱuQ{Ǹ$w _ìռf nj9)HETbTzEW>$BxV .VZPMvy:~&r'[W`$ߏC'4yTFfWg_KQ 2?,9MTi>Raw <$1hJ>FK4c\kƥLXR_tv[%b=SLmWY2LzndΑx}(FogV˯/uk%niy쫳6XOM}:4şYn&Ws $Ml0#|"> %[ĄNIV%kr(i$pF[vGA-4;O"B[@ɿ[B'pW T6[8/IݐH,ٰMM*2^[+[~y0SzT?,\yNRpFjkCŪx_jZ"s&hLr^E9;ȩm*e_0f>l>:Y'ז> '!+nO [#tqvH= |^oJ4Bzu$)Dsm[Giۘd# .28XHc;g%2 7J 80aGs@E({۹4\wn5S*<dOHY=4ہJj D*8J"zJMUKt uJZOT~Ard*(z1 @DT̠ n¬ȡSCP3qXCWƌӒ#@?9%Z('nYSo| rpDL rp7A r,xG8Я Mo3܂e<4RrNF+I5UV<$8nW|; qPfI^ѐm. ҵ9& 8a7_IUs1e;ݕ|XH)y`HiDRΙT0/ҒJc3o*t´PܿąTM+|A&ɬrQzu#-b]E%jFR+1 hUζmJb}Kk:2֋Vӣ|RHMַC7.pI$V#L'ABA+WLJAX\U2jݱ dۍ*ʔ-ͣHzP]aM"~4CV[H痞pQFnDdqqR3-V1LR{K4kL^Y{;RQ/ M!Li)/{q[i) [o??u6o}t'-Mr/F[EtnvᑈQiS=ixjF )ϧ3, X{(ޘA*O,5l-US~ۭ]9/wݺ<)D(c 0-^{Gm3.w6亮{CoDוՄ2N7 ǹ>D]]f'Z EJWB *.k\s$2 nizĭY k_>_%]s蓟iKkYC hR9&%ĢO#EAQI5:h^tt"uYjuGZ״CY=i="oOob~gFcoS Fv2|daߥQ. G,Sn1P `bqe$.ͤ& Deέy I,m]1?ZfnD;eʂ$D$ڮx[,w\Sv>VpKOfD!+q sک @WDNA`[G @wU&78i6no}NG.te5;gG8*`_ F D{~n?ދdMlMaj|Ut#(αOO7Mz=8Akw3 >͖/VP-fNTf3P?2:Gj_QZv_& .BKdPH|hэ%RXsގi> dv,kiAdK Nd\[^bOSì8]n6HE T  pqw6Hy-d*f|O'omJ)/W kTVByoHHr<t/)P|ff65T \KĹ`;ϋ󵮎N#:ƃrTFx'1)n># 卆oJQVI{Vy I<ȋ[ 36g/FyF :\%XX4|D 7! [|N 512a;]qnWަJ4Q&uex?O 6uB{,'٩ct8.`(qWuZYŎfGZOWc*@6!9tSNJΠZC"2Ґ9# u_ugdbrEC Nn@kDܿ_u Ř4Fdudk-|:o%Jo: .r Eާɋw^80,4@>ݏ_Wįs@gǯn dd1"z@žgPRBmR( ;W[ gm/obfJ"dIцGAQ! T;Y;T∹\SFD&ʩ+@gU D?}M\ xT gl\%eHl.3;d!pHZ< h'3UG}1;Gpit%2@VniaD)GoBs%Av rMЀMԼ?~eoXXKOB-0I݂vbsnMX09/P~U k/1n@TflYAfd,r wr]}2)gլHt:\|*h9?UbB5v+ޏ<~ө8݌(}t$ f%GNAH$S|CA"gN' NeQoL'$=hx6y)F~M_F|JZjM59Zh .Ks9Ymk.(=WN?Օn ںKlNRvlLC7jo}1~x`wf{5iFR=!]ԛCXr$bHAMۖ.X!ܞ48GdG¨71ܺUD(/9P #ސz.p!oUѠJ<l̶l _Q Il~DLf ׼s3 \FN*kW;n10Xw㦆U% rkx;YukIHhbZ|uTbkw{C<Ǘ,I5= `b("^ۯe;r1G,sz6Z Phj󱲗.wr[7ow8]"%W6Z(Dd(ϫ 0ԧ?Q%zW-p1yNA.myM=p/ / vH3狒3pl`  YZ