ntpsec-utils-1.1.0-lp150.1.18 >  A Zu/=„M^@Km&zЄE$z=˽tRlXt[3 <<$yS?5H#@YjmcBft y _\YTsn/ " Q{DpLx?hd  ?x| `  h  (  ` XPt  X (8-9H-:-=>?@FGHxIXY\]|^bcdefluvdwxhy z"dCntpsec-utils1.1.0lp150.1.18Utilities and commands for ntpThe ntpsec utilities relying on the python module of ntpZclamb13yopenSUSE Leap 15.0openSUSEBSD-2-Clause AND NTP AND BSD-3-Clause AND MIThttps://bugs.opensuse.orgSystem/Basehttps://www.ntpsec.org/linuxx86_64 test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in ntp-wait.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in ntp-wait.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-ntpsec-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-ntpsec-update-$service-new-in-upgrade" fi done for service in ntp-wait.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset ntp-wait.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in ntp-wait.service ; do if [ ! -e "/run/rpm-ntpsec-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-ntpsec-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in ntp-wait.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable ntp-wait.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop ntp-wait.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart ntp-wait.service ) || : fi else # package uninstall for service in ntp-wait.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fiF V#MM_w: %QY%큤ZXZXZXZXZXZXZXZXZXZXZXZOZ]ZZZZZZZZZ\ZZZ[Z[Z[ZZZZ032338571b2dfb414ae666502de0d23878e929182b63d64c28c4874164ef98a8a3ead1e91bff607ac7e823c97bfb2f97eeeee9f69db6b275c78f6351111c0f8529f7a6e4b268381689e47e51b2e1eb429b6e28dffccee7475c729769c7416ab9642baa152ce800feb5e6d4e62f515d186288e8079d3abe471d549e7a45f3af53acd195423e55a26ff5d1ef8deba336b22a5af7fa650c9b68cf3ea2f1e0973f419227daf355916d745d55921407ad673a5441b236ed295a84fc5a5cc9a31da21e984169255c66ffa51f6a6f8dc9f54a1a7695eff16625f9f3d4d5f487eb4c5e7bd44e4286f206efa98a244ac052998fa678405d1d48f12aabbdf1196d781fa6813aa484e660b1d88478f9e7ede96793fbe21789a8693b6e3bab844b6c64d36b22f572e3ecaaccce40d7aaf59334f71a86f8e0364cf7f39bb8d5776e126dbe235fca8ab67cea86f678f8f7d9616b04f7ff73e84530cc52c27d68f84122cdeea77e5826c40914fa66473438c7c0b5f0f464bb24a1ab001ce08fe4db88660e8bdfcf61c0b0e7f4eb42692f774dcfd9e5dd942692ccbcfbfcf25598dd86a2127bbec0b7dfba8d4c07e90fbc3920345fda8b82d7a6e4ecde8a1b610a95a2c4255e6d162a8e9ed267ea26756c6c0fa92c64ec1cf2893eed8ab07061d34001c34b5bee20016d641b96f7d25ae71c4466a274340070cd7e934cd9f7d5db68956f1e73699c62b9f9405f9617fcdbb6a18e7033118c483e32a6133cfef378549196d514fa4d8958969ee6d4fac20c192db717465ac279d2f6fff471df6318b0bc823f3014386d68b106fbdadd80090232a4089bd0d9e6680b9a856e5934bd3d04eae611a0ced202aa79218b837bc8cf8125a4ce8d76abffdd86eb30b32bdc950b79932fc4f2d896ea01f19b1de6bc33d52ca6947a7a8739b4028437a8a7ab51dc39b124291111071d98b1d5bf39ef5f49b42c7176ecd3f18e3b0b0beee6ad24cad05eb99e225f7f6d00043dc85a493d60488267d3ba72284fdef5cece8bc8f2575a72387c75servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootntpsec-1.1.0-lp150.1.18.src.rpmntpsec-utilsntpsec-utils(x86-64) @    /bin/sh/bin/sh/bin/sh/bin/sh/usr/bin/python3ntpsecpython3-gpsdpython3-ntprpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.1.03.0.4-14.6.0-14.0-15.2-1ntp4.14.1Z@ZOZ Z@Y*@Y@Y@YYYYJYX@Y7Y7Y(Y(Y&@Y!@Y /Y@YtYtX:@XEXQ@X @Xh@Xh@Xh@Xh@Xh@XXXX"@X@X@X-X-X-X@X@X@XXGtchvatal@suse.commpluskal@suse.comtchvatal@suse.commpluskal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comjengelh@inai.detchvatal@suse.comtchvatal@suse.comopensuse-packaging@opensuse.orgtchvatal@suse.commpluskal@suse.commpluskal@suse.commpluskal@suse.comtchvatal@suse.commpluskal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commpluskal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commpluskal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.commichael@stroeder.commalcolmlewis@opensuse.org- Version update to 1.1.0: * Digests longer then 20 bytes will be truncated. * We have merged NTP Classic's fix for CVE-2018-7182. * we have dropped support for Broadcast servers. We had kept it for older desktop operating systems listening on the local network broadcast domain, a use case that is now no longer in use at sane enviroments, and no longer necessary for modern desktop OSs. * It is now possible to unpeer refclocks using a type/unit specification rather than a magic IP address. This was the last obligatory use of magic IP addresses in the configuration grammar. * OpenBSD has been removed from the list of supported platforms for ntpd. It will be restored if and when its clock API supports drift adjustment via ntp_adjtime() or equivalent facility. * Mac OS X support has been dropped pending the implementation of ntp_adjtime(2). * A bug that caused the rejection of 33% of packets from Amazon time service has been fixed.- Switch to python3- Update to version 1.0.0 instead of git snapshot: * mostly contains all the previously mentioned stuff nothing else changed- Update to version 0.9.7+git20171109.2d88a7d84: * Remove two unnecessary functions. * Changed MIB system to use seperate read/write callbacks * Boolification. * Nuke ifdefs for O_NONBLOCK and O_NOCTTY * Drop use of pthread_addr * Fixes instructions for disabling Apple NTP. * Added MIB coverage * Address GitLab issue #407: ntpdig/ntptime fails against some servers * Removed obsolete MIB tree-list converters * Changed ntpsnmpd to use the new MIB tree system * Added walkMIBTree generator to replace previous MIB tree handlers * Squelch a compiler warning. * Address GitLab issue #406: ntpd build fails: ... * Bump the minor version number. * New syntax: unpeer clock [unit ] * In the config parser, factor out type/unit lookup into addr_from_typeunit()... * No point in removing individual generic-driver modes... * endian.h does not suffice, as there are no 64-bit primitives. * Dead-code removal. * Move some TOSO items that didn't land pre-1.0. * Remove obsolete TODO items. * De-dummyified several OIDs * Added option to put a space between the value and unit in unitify() * Typos in comments * Some pep8/pyflakes cleanup * First Mode 6 - SNMP contact * Removed redundant, and non-coherent getNextOID() function from getOID() * Added and used sendErrorPacket() method * Added AgentX sessionID error check and response * Added slots for agentx write callbacks * Cleaned up and updated comments * Expanded error checking for SNMP * branch change * Python 3 fix for test error * Changed error handling in decode_packet to return remaining data * Documentation fix * Added doc files for ntpsnmpd * Added ntpsnmpd in prototype state. * Fully split SNMP uint32 vs int32 handlers * Correct SNMP INTEGER value to be signed * Changed new tests to only use assertEqual * Added >= and <= comparison functions to OID class * MIB tree/lists now have callback fields * pep8/pyflakes fixes * MIB tree/flat conversion functions now use OIDs instead of tuples * PEP8: W291 trailing whitespace * Move humanlogtime() to msyslog.c since it's only used there * Added list conversion for Python 3 compatability * Added MIB tree flattening and inflation functions * Removed unused function humantime() * In devel, turn release into a script generator. * update NEWS file for new work * version 1.0.0 * Fixes for release machinery. * Removed temp debugging statement, changed constants to be 32-bit safe * Added temporary debugging message to test_util (re:bug #404) * Fixed test_summary to properly test last_sync field. * Fixed test bug on Cent 6 32bit, also SyncPacket formatting typo * Remove s historical remnant in the documentation. * Added documentation and fixes for float tests * Restored missing decimal fix, changed relevant tests to be float aware * Restored previously removed tests, fixed math problem. * Removed unnecessary tests that failed * Banish GCC 6 warnings. * Updated comments to document sys.stdout.encoding being fake news * Possible fix for ntpq unicode issue - Rename python subpackage to python2- Update to version 0.9.7+git20171002.c79bc6271: * Fix a comment that became incorrect after the autonomy change. * Fix GitLab issue #378: Misc warnings on RasPi * Address GitLab issue #380: ntpq should not terminate with a traceback * Attempt to suppress some compiler warnings. * Don't build with -Wcast-align * Fully disable -Wcast-align. * Suppress another useless warning. * Abandon -Wsign-conversion, it's too flaky to be useful. * -Wsign-conversion is unreasonably difficult to stamp out. * Revert "Attempt to suppress some compiler warnings." * Restore build under clang. * Finish rationalization of config block copy. * Thinko fix. * Trial implementation/docs of RFE: Add fudge option to server config * Added tests for missing values in __parse_varlist * Fixed broken test for cook() * Added missing tests for several functions * Explain a scenario in which bias configuration might be useful. * Don't scale the bias report - use units of seconds. * Addtress GitLab issue #381: simple mathematics * Fixed / completed test for NTPStats.__init__() * Change prettydate() to always emit UTC, for reproducibility. * Fixes tests for cook() to match new prettydate() * Address GitLab issue #383: ntpq: invalid file argument ignored * Grammar * Fix spelling of "received" * Typo fix. * Suppress a false-positive Coverity warning. * branch change * Finished tests for statfiles.py * Revert "branch change", a temporary commit I forgot to rebase. * Finished tests for statfiles.py (for real this time) * pep8/pyflakes fixes to tests * Formatting fixes for packet.py * Formatting fixes for util.py * Update NEWS file. * Fix a linkcheck warning. * Update idex-ignores. * Typo fix. * Removed ntpq packet dump comment from TODO because obsolete. * refclock_nmea: check snprintf() return codes. * refclock_nmea: fix a typo, and a long line. * refclock_nmea: provisional fix for issue #62. * Documentation updates. * Doc polishing. * Spelling/typos * ntpq: do not query for bcastdelay removed in Dec 2016. * Tore NTPStats.__init__() method into 3 separate methods, adjusted tests * refclock_nmea: report device actually opened. * refclock_nmea: add logging of NMEA PPS device name. * refclock_nmea: remove trailing whitespace. * refclock_nmea: better logging of NMEA open fail. * refclock_ntpsec: missing braces... * Address GitLab issue #388: Remove 'register' keyword * refclock_nmea: set jitter high on NMEA timeout. * Docs: add tally code to ntpq and ntpmon doc. * ntp_proto: once a PPS got selected, it never got unselected! * Attempted fix of trimble logging * refclock_trimble: invalid UTC offset doesn't mean invalid packet * refclock_trimble: fix classic bug 2659 * refclock_trimble: build Praecis SPSTAT message response in trimble_io * refclock_trimble: use timecode packet's timestamp * refclock_trimble: check serial parity * refclock_trimble: require event polling for non-Thunderbolt receivers * refclock_trimble: remove unused and unnecessary code * refclock_trimble: improved debugging messages * refclock_trimble: fix leap-scheduled detection, simplify polling * refclock_trimble: add Thunderbolt holdover and stored position check * refclock_trimble: configurable event trigger method * refclock_trimble: print a debug message when no packets were decoded * refclock_trimble: remove redundant debug messages * refclock_trimble: fix for classic bug 1075 * refclock_trimble: improve 'no packets detected' message * refclock_trimble: set dispersion * refclock_trimble: use the median filter * refclock_trimble: add log message topic labels * refclock_trimble: check tcesetattr and ioctl results at startup * refclock_trimble: pass 4-digit year through refclock_process() * refclock_trimble: update documentation * refclock_trimble: time2 sets holdover duration limit * refclock_trimble: compat. with 'attempted fix of trimble logging' * refclock_trimble: fix 'attempted fix of trimble logging' * Documentation polishing. * Documentation polishing. * Fix generic refclock logging. * Reduce memory usage by removing an unneeded strdup(). * Note that the TrueTime 468-DC mode is obsolete. * Address GitLab issue #390: Need log message when the clock is stepped * ntp.d: change .ntpd extention to .conf. * In TrueTime driver, remove last remnants of OMEGA support. * In TrueTime driver, remove GOES support (sats shut down in 2005). * Documentation polishing. * Remove Magnavox driver. * Typo fix. * Remove unused PLATFORM_OPENBSD config symbol. * Remove unecessary estrdup() in NMEA refclock initialization. * Note that on some HP-GPS devices the era can be reset. * Mitigation strategy for clock rollovers. * Markup fixes for generic clock driver HOWTO. * In clock_sample(), prevent jitter from zeroing if all samples are bad. * Use poll iburst in the sample config files; it works now. * Typo fixes. * Revise and update example config files. * Address GitLab issue #392: combine /etc/ntp.d and /etc/ntp-conf.d * Bugfix: enable reading config directory when there's no ntp.conf, * Log all time steps (GitLab issue #390) * Documentation polishing. * More documentation polishing. * packet.py tests now work with Python 3 * util.py tests now work with Python 3, fixed missing future division import * Documentation polishing. * refclock_trimble: fixes for debug print, comments, documentation * Use ISO8061-format dates. * ntpviz: add decode of PPS(x) refclock name * ntpviz: add decode of NMEA(x) refclock names. * Disables useless pyembed check and setup. * Fixes incorrect Python library install locations. * Fixes Python in-tree build setup. * Suppresses wafhelpers .pyc files. * Adds cleanup for incorrect Python library installs. * Removes all PYTHONPATH references. * Adds build-time warning when PYTHONPATH is set. * Fixes misleading ntploggps error when GPSD not installed. * Removes execute permissions from client and test sources. * Repair the option tester. * Renove a magic link obsolesced by PYTHONPATH changes. * Fixed problem with python3 and python3.6 versions * tests/option-tester.sh now gets ntpq from $build/main/ntpclients * Restore accidentally removed creation of a magigic ntp/ link. * ntpviz: Add Python 2.6 compatibily fix. * ntpviz: Python 2.6 has no collections.Counter(), use defaultdict() * ntpsweep: fix crash dump on Python 2.6. * Adds test program to list Pythons and some of their parameters. * ntpleapfetch: do not wait forever to read the remote leapfile. * ntpleapfetch: allow sha1sum or shasum to be used. * ntpleapfetch: It is only an error if the program does not continue. * ntpleapfetch: fix chmod/chown on CentOS * Fix for packet tests so they can run wiithout a tty * Fix for missing socket.EAI_NODATA on FreeBSD * Python library files don't need to be executable in the build tree * Modify FixConfig to apply PREFIX to Python library paths. * Changed OIDs to be classes instead of dicts * Transplanted OID comparison function into OID class * Converted Search Ranges to a class * Converted Varbinds into a class * Rearrangement of some functions, and pep8/pyflakex cleanup * AgentX code and tests now work in python 3. * Run python tests using gitlab ci IFF python >= 2.7 * Fixes unicode bug under python 3 * Removed obsolete comment regarding removal of IO wrappers * Removed some single use variables from stringfiltcooker * Changed unnecessesarily snarky and factually inaccurate comment. * Restored IO wrapper for OSX ascii streams. * Restored comment describing stream wrappers * Remove 15 instances of make_wrapper(), none where ever used. * ntpq: no need to translate input, all input is ascii. * ntpwait: remove unused/unneeded UTF-8 stuff. * make-leap-seconds: remove latin-1 and UTF-8 cruft. * ntpq: force utf-8 output in Python3. * ntpq: remove debug print() * Added python 2 utf-8 output enforcer * ntpq: only import codecs on python2. * Added function to replace UTF-8 units with ASCII-safe versions * Changed ntpmon to detect the unicode-refusing encoding and compensate * Removed forgotten debugging statement * Generalized previous ntpmon fix to any non-UTF-8 encoding * Fixed ntpmon unsupported locale bug * Updated ntpmon documentation to include known unicode bug * Removed forgotten debugging statement * Possible fix for unicode/locale bug * Added test for deunicode_units * Added comments to some utility functions * Added/adjusted comments in agentx * Mostly resolve and document FHS conformance issue. * Moved makeflags function from test_agentx.py to agentx.py * Changed decode_pduheader to use makeflags() * Added, tested, and put to use new flagbyte functions * Typos in docs/driver_nmea.txt * Polish library path resolution and docs. * In the release script, isolate a parameter. * Documentation polishing. * Address GitLab issue #402: ntpdig: no fraction of seconds- Update to version 0.9.7+git20170906.6b1b54aee: * Rationalize a configuration-block copy. * Remove an obfuscatory macro. * Address Gitlab issue #376: Need a symlink from ./tests/pylib/ntp * Force struct pkt to maximum alignment on the host machine. * Address GitLab issue #375: ntpd terminates unexpectedly * It would be nice to put the NULL guard on the right line. * Ignore ntp symlink at the third level as well * docs/rollover.txt: Fix headers. * Add python3 gitlab ci target * Address GitLab issue #379: seccomp crashes ntpd * Correct seccomp whitelist change in previous commit. bsc#1057209- Conflict and provide ntp-daemon instead of ntp directly- Fix silently obsoleting ntp wrt bsc#1055821- Update to version 0.9.7+git20170905.2bd5e61d6: * Too many members named 'count'. Distinguish one. No logic changes. * Address GitLab issue #367: reslist counting wrong rule * Documentation polishing. * Create and document topic labels for log messages. * Added tests for Authenticator() * Added tests for maic contents of packet.py * pylint: import print_function from future for python2/3 * pylint: remove unnecessary parenthesis * Added tests for Packet(), tweaked Packet to not use magic number. * TODO update - we now have a pointer to Debian packaging metadata. * Add script useful for timing ntpd startup * Fix for iburst on DNS for both server and pool * Added tests for SyncPacket, tweaked SyncPacket * Added tests and tweaks for ControlPacket() * Address GitLab issue #237: documentation refclock pps missing unit description * Address GitLab issue #368: warning on openbsd 6.0 with gcc 4.2.1 * Address GitLab issue #399: ntpq config command is config-from-file * Fix a minor glitch in processing of config_from_file... * Improve the ntpq help display. * Typo fix. * This is the spec file and README for creating an RPM package * Comment polishing. * Remove references to .refclockd extension, since that plan has been dropped. * Documentation polishing. * Expanded packet.py tests to test error handling. * Added aliases for frequently used objects * Moved slicedata() from agentx.py to util.py * Pythonized __parse_varlist() * Added comments and removed forgotten debugging statements * Removed excess parentheses from former C macros * Fixed scrambled data storage in SyncPacket() * Changed multiplications by powers of 2 to shifts * Fixed error in posix_to_ntp: it recieves floats so it can't shift * Removed unused argument idx for ControlPacket.stats() * ControlPacket() now consistently uses extension, not data * Moved slicedata() test to test_util.py, expanded test for edge cases * Rewrote dump_hex_printable() to be pythonic * In pylib/util.py, refactor DNS lookup caching... * Fixed mis-named variable * Fixed string error in __parse_varlist * Address GitLab issue #370: ntpq :config * Cleaned up IfstatsSummary.summary() a bit * Updated comments in __parse_varlist() * Update phone number for USNO Colorado Springs, CO * Fixed scrambled unit abbreviations * Replaced magic number for keyid with MAX_KEYID * Replaced decimal with hex number for better semantics. * Address GitLab issue #371: ntpq ugly traceback * Updare to porting guidelines. * Narrow our depenency on nonstandard code. * Comment polishing. * Revert "Comment polishing." and "Narrow our depenency on nonstandard code." * More thoughts on NTPv5. * Changed incorrect if to elif * Adjusted parentheses in __validate_packet version test * Added tests for util.py/f8dot4 and f8dot3. Bugfix in f8dot3. * Simplify passing configuration data to the peer-creation logic. * Added tests for Cache(), Cache() now deletes expired entries. * Necessary followup on previous commit. * Documentation polishing. * Platform-support update. * Moved generally useful test jigs into jigs.py * Added test for canonicalize_dns(), added necessary support to test jigs. * Fix comment glitches. * New documentation page om rollover problems * Added stub test for termsize() * Added separator comments for PeerStatusWord.__init__() * Removed redundant assignments from PeerStatusWord.__init__() * Swapped positions of reachable/unreachable assignments to match magic numbers * Added tests for PeerStatusWord * Removed clk_wander_threshold from PPM_VARS * Added tests for cook() * Allow refclock sample processing to use 4-digit year timestamps. * Documentation followup on the autonomy fix. * More followup on the autonomy change. * Added test for termsize() * Fixed test for rfc3339() to handle python3 * Simpler version of autonomy code - avoid CLOSETIME clipping. * Restructure the peer block to keep the peerctl structure intact. * Ensure that all members of a command-line configuration block are zeroed. * Address GitLab issue #374: ntpmon crash with Server error code BADASSOC * Added test for MRUSummary() * Added test for ReslistSummary() * Added test for IfstatsSummary() * Fixed broken test for ReslistSummary() * Fix signedness glitches. * Add an overflow warning. * Fix brown0paper-bag bug in clocktime computation. * Added tests for PeerSummary() * Show the actual C compiler/ld flag name in the configure output * ./waf distclean is a built-in command, not a sub-type of build- Update to version 0.9.7+git20170817.d22a11af7: * ntpmon: make MRUSummary() dynamic on terminal width, not hard 79. * Partially address GitLab #212: waf needs some tlc * Address GitLab issue #322: ntpwait should not terminate... * Fix example to remove unsupported syntax. * Dispel murkiness about the configurator restrict operation. * Document a corber case in the behavior of ntpq -n. * Address GitLab issue #277: 32 bit OS warnings * Implement generation of CMAC keys for draft-ietf-ntp-mac-01. * Record in NEWS that AES-CMAC authentication hashes are supported. * Document new features. * Don't duplicate the keyboard error handler in ntpwait. * Address Gitlab issue #355: ntpq traceback on macOS * Deal with the fact that unqualified except catches SystemExit. * Documentation polishing. * Revert broken CMAC implementation * Address GitLab issue #58: GPSD_JSON doc does not match the code. * Remove mislrading comments. * Address GitLab issue #274: functions fail to inline * Drop support for OS X 10.11. Apple screwed this pooch too many different ways. * Eliminate u_int, u_short, u_long. u_char homebrew types. * Fix GitLab issue #357: mrulist crashes * Address GitLab issue #214: waf "host" part of the build doesn't use our CFLAGS * Replace an obsolete BDism: (caddr_t) becomes (void *). * Minor changes to reduce dependence of Linuxisms and glibcisms. * Replace deprecated usleep(3) with POSIX-compliant nanosleep(2). * Document the assumptions behind our C dialect switches better. * ntpwait: fix issues #358, return exit(2) on control-C * Address GitLab issue #314: Forward-confirmed reverse DNS * Address GitLab issue #359: Warning on Solaris with gcc in msyslog.c * Document a minor limitation of ntpq :config. * Add a warning that ntp.d support is unstable. * Add pointer to Debian packaging metadata. * Address GitLab issue #314: Forward-confirmed reverse DNS * Make ntpwait in verbose mode report seconds elapsed to fix. * Address GitLab issue #361: Warnings in ntp_loopfilter.c on Solaris... * Address GitLab issue #356: reverse function for restrict * Note that "config" and ":config" are now synpnymous under ntpq. * Fix fatal error in config-directory code. * Due to an obscure feature of ntpq syntax, config can't be mapped to :config... * In ntpq, repair a bug in the interpretation of :config. * Address remaing part of GitLab issue #348: unpeer failing on invalid hostname. * Armor ntpwait's report of time to sync against NTP clock stepping, if we can. * Add "Caveat for Crossbuilders" to INSTALL. * util.py: Python 3 has no type long. * Fix bad interaction between memory allocation code and restrict mode field. * util.py: Python 3 has no type basestring. * Another fix on Python 3 missing basestring and unicode() * ntpmon: more unicode() removals. * Document why our kuge for in-place testing fails under Python 3. * ntpmon: Python 3 fix, remove uneeded/broken UTF-8 conversion. * ntpwait: fix for Python3, %.1f time precision, pep8 * Typo * PEP8 cleanup * In pylib/util.py, use monoclock() for DNS timeouts. * Fix typo in comment * Address GitLab issue #365: linking fails on OSX 10.13 with Xcode 9 * Implement unrestrict with address and no flags to remove a rule. * Documentation polishing. * Document no-flag case of unrestrict. * Documentation polishing. * Partially address Gitlab issue #270: Loss of precision in step_systime() * Remove repeated words in comment * Added tests for packet.py/ControlSession() * Follow up on doubletime_t change. * Restore incrementing of some counters lost in the rotocol refactor. * Avoid a core dump due to null peer during pool query. * Avoid a Coverity warning. * Address Gitlab issue $312: pyc generated files do not have... * Ripped packet validation code out of getresponse into its own method. * pep8/pyflakes tweaks- Update to version 0.9.7+git20170810.8273a59ac: * Added /* SPECIAL DEBUG */ token to lines previously missed * Solaris: Start to fix a893edc7fa5fdf05b7558c46b2e83db9c7a0881b * libisc: remove code in $ifdef __hpux * SO_TIMESTAMP, comment that macOS uses this packet option. * libisc: Condition isc_netaddr_fromin6() and isc_netaddr_islinklocal() * libisc: move libisc/net.c to libntp/isc_net.c * libisc: move libisc/error.c to libntp/isc_error.c * libisc: move libisc/interfaceiter.c to libntp/isc_interfaceiter.c * libisc: p00f! * waf: remove uused variable srcnode. * Merge 3 #ifdef __linux sections * remove some stray spaces. * remove isc_mem.h and the sily macors it had. * Merge refidsmear.h into net_fp.h * move gpstolfp.c back into libparse * Fixed logging bug in ntpq * LISTs: remove 4 unused macros, comment out unused debug code. * SHM: change implicit casts to explicit: (enum segstat_t) * Sandbox: comment on odd Apple behavior. * Change netof() to netof6(). IPv6 only. * restrict: Ignore CIDR in restrict address. * Replace "uint" with "unsigned int" * Typo * Properly set compatibility defines for Solaris * Update capitalization of macOS to use new official style * Update devel/TODO * Add waf quirks to devel/TODO * ntpq interactive switch shot by firing squad for redundancy * More work on devel/TODO * restrict: add CIDR notation. * restrict: add short explanation of address/cidr notation. * restrict: oddly restrict is documented two places. * sandbox: add missing shmdt. * Updated incompatibilities with info about ntpq -i option. * Fix for "not in address table!", Issue #338 * Drop support for SO_BINTIME * resrict: fix format warnings. * More tweaks to devel/TODO * An observation about performance. * Make sure NTP_API is defined before checking the value * docs, bsp, and info are not implemented waf commands * seccomp: add a missing Gentoo ARM syscall. * seccomp: improve mmap comment. * seccomp: Make the #ifdef match the macro. * Fix problems with ntpq debugging flags. * Fixed missing information and incorrect formatting in ntpq docs. * Fixed incorrect formatting fix * Fix errors in ntpq argument handling and docs. * Updated ntpq options description paragraph to reflect modern ntpq. * ntpq now attempts to display srcadr if talking to NTPclassic * Rename of ntpq long option log-to-file to logfile (same as ntpd) * Add CentOS 6/7 jobs to GitLab CI pipeline * Add Debian Wheezy to GitLab CI * Add Fedora 24/25 to GitLab CI * Generate documentation via GitLab pages * Add ntpq packet dump to devel/TODO * Add decimal gai error code to printout * Fix for Issue #340, 100% CPU and segfaults * Fixed missing address/hostname for pools that return "::" * Partial fix for ntpmon crash * Fixed ntpq debug command to not open a logfile on its own. * Added logfile command to ntpq. Same function as -l option. * Updated ntpq docs to reflect new logfile option. * Remove last_ttl from struct endpt * add packaging/ directory * Add SUSE .spec file from open build service * Added agentx library and tests * Fixed ntpq usage message: still had a reference to the -i option. * Add prlimit64 to seccomp list * Added response error codes * Changed ntpdig -p option to poll servers instead of limit server count * ntpdig now properly accepts -g/--gap option * Changed ntpdig -g to accept milliseconds, matching docs. * AgentX x-coders now return dicts instead of unreadable tuple-forrests * Added detection for cropped packets to decode_packet() * Moved read_append() definition out of loop * Adjusted sleep behavior to be more logical * Remove stray semicolon in NS_PER_MS macro * decode_searchrange_list can now handle lists without a null-OID terminator * Fixes for searchrangelist, functions that use them, and tests * Changed packet representation to classes. * Added packetVars() and tests * AgentX packets now have working __repr__ function, and tests * rv: Always put space between flash code and flag names * Added compareOID function and tests * removed unneeded panens, make some indents standard (4 spaces). * Fix more unstandard indents. * A slightly tigher test for mode 6 data. * Added little endian tests for all PDUs * Added little endian tests where missing * Added test_pducore test helper, tests are now shorter and more complete * f8dot4() now supports Nan, and fewer returns. * Fix sometimes not-initialized estdisp * Address GitLab issue #330: no common notation for refclock * Address GitLab issue #261: mru minage/maxage docs look incorrect * Address GitLab issue #325: man ntpwait incomplete - exit status 2 * More input validation for PeerSummary.summary() * Decode all(?) 'variables' sent to PeerSummary.session() * Fix line too long for pep8 * Improve decode of rec and reftime. * Tidy up an indent. * Decode stratum only once * PeerSummary.summary(): make sure all vars are intialized * prettyinterval(): do not crash on bad input * test variables['refid'] exists before using * ntpmon: pep8 tweaks * ntpq: sort imports * ntpq: pep8 cleanup * ntpdig: fix pep8 nit * ntpkeygen: fix pep8 nit * Added dolog and tests * Add comments to unit strings * Add wideremote to MRUSummary, like PEERSummary. * Make f8dot3() not crash on bad input. * Have f8dot4() and f8dot3() use string constants for signals. * ntpmon: allow 'h' in addition to '?' to display help screen. * More hardening for f8dot3() and f8dot4(). * ntpmon: rearrange peer detail a bit * ntpmon: fix line overflow of version line * ntpmon: make w tottle MRUSumary too * Add ntp.util.stringfile() to pretty print filt* * remove commas from ntpmon detail display. * ntpmon detail, remove more commas. * ntpmon: more detail view cleanup. * ntpmon: fix overflow on version line * Fixed severe oversite in dolog() and tests * Logconversion * Address Gitlab issue #327: documentation refclock pps missing unit description * Address GitLab issue #285: Configure tests fail with old version of ld * Address GitLab issue #326: Motorola GPSes reporting that it's 13 Oct 1997. * Note in NTPsec changes file that restruct accepts CIDR notation. * Fleshed out ntpmon's logging abilities * Fixed packet log dump to repr() the data instead of vomiting * Try 4 times to get Nonce. Don't give up on first failure. * INSTALL: typo. * ntpmon detail mode styling * Revert an attempted but failed workaround for a build bug on old OS X. * Upgrade to waf 1.9.13.- Add HUP call in logrotate postrotate. Thanks to Hall Murray for spotting- Enable more options and refclocks by default- Add conflict even to utils package to make factory bot happy - Update to version 0.9.7+git20170607.7c0008c91: * Address GitLab issue #316: "ntpd" dies unexpected unpeering a refclock * Address GitLab issue #322: ntpwait should not terminate with a traceback at SIGINT * Fix for issue #334 - restrictions using ephemeral copy of address. * Another try at fixing issue #334 * Fix for Issue #335 (-Wsign-conversion) * Fix for Issue #339 (-Wsign-conversion)- Fixup wording in description.- Add conflicts and provides to allow it to live in Tumbleweed- Update to version 0.9.7+git20170525.464804153: * Catch ntp.packet.ControlException in ntpwait * ntpdig: Use python's built-in UTC offset variables since they handle DST * Remove duplicate check for enabling of leap smear option * libntp: make ntpcal_ntp64_to_date() static * libntp: make ntpcal_days_in_months() static * libntp: remove unused function: ntpcal_daysplit_to_date() * libntp: remove unused function: ntpcal_daysec_to_tm() * libntp: make get_ostime() static. * libntp: add missing static to atexit_ssl_cleanup() * libntp: remove unused finction sockaddr_masktoprefixlen() * libntp: move convertRefIDToLFP() into tests/libntp, make static. * libntp: remove unused function ntp_be16enc() * libntp: remive unused function ntp_be32enc() * libntp: remove unused function ntp_be64enc() * waf: show loccount in .waf help * libntp: Move +ymd2yd() into ntp_calendar.c. * libntp: make errno_to_str() and addto_syslog() static. * libntp: make mvfprintf(0 static * libntp: remove unused mfprintf() * libntp: move msnprintf() to tests. It was only a test helper. * tests: rearrange to eliminate an #ifndef. * libntp: move mstolfp() to be a test local. * libntp: remove emalloc() which has been commented out for a while. * libntp: remove unused ntp_gettime(). * libntp: make auth_moremem() static. * libntp: move atolfp() to a static in tests. * libparse: remove unused get_mbg_svno() * libparse: make get_mbg_health() static * libparse: make get_mbg_cfg() static. * libparse: make get_mbg_tgps() static. * libparse: make get_mbg_tm(0 static * libparse: remopve unused get_mbg_ttm() * libparse: remove unused get_mbg_synth() * libparse: remove unused get_mbg_tzdl() * libparse: add missing prototype for get_mbg_comparam(). * libparse: remove unused get_mbg_tzname() * libparse: remove unused get_mbg_portparam() * libparse: remove unused get_mbg_comparam() * libparse; remove unused -get_mbg_eph() * libparse: remove unused get_mbg_alm() * libparse: remove unused get_mbg_iono() * libparse: make parse_restart() static. * libparse: remove unused parse_iopps() * combine two copis of days_per_year() into one. * libparse: remove unused syn_simple() * libparse: make pps_simple() static. * libparse: remove unused pps_zero() * libparse: make implicit cast into explicit one. * libparse: make 2 implicit conversions explcit. * libntp: maike implicit conversion explicit. * remove uslelss extern keytype_from_text() * remove unused typedef and extern: pset_tod_using set_tod_using() * ntpd: remove unused rereadkeys() and ntp_exit() * ntpd: remove redudnat (void) cast on function returning void. * remove two uneeded externs: octtoint() and ranp2() * remove unused extern: clockname() * libntp: make syslog_fname and syslog_abs_fname static. * remove two unused externs: ntp_tty_setup(), ntp_tty_ioctl() * remove TTY define from header, put in the one place it is used. * remove unused trimble_scmds[] * libparse: remove unused array, and wrong file comment. * remove unused extern: get_free_recv_buffer_alloc() * mbg_gps166: remove lots of unused cruft. * ascii.h: remove many unused defines. * mbg_gps166: remove unused SYNTH stuff. * mbg_gps166: remove unused header cruft. * mbg_gps166: remove unused macro * ntp_assert: remove Calypso support. * tests; remove duplicate is_leapyear() * ntpd.h: remove unused define. * ntp_control: make ctlsysstatus() static. * ntpd.h: remove unused define. * ntp_io: remove unused interface_enumerate() * ntp_io: make findbcastinter() static. * ntp_io: don't duplicate latoa(pif) & localaddrtoa(pif) * ntpd.h: remove unused sys_clocktime * ntp_peer: make peer_reset() static * ntpd.h: remove unused extern process_packet() * ntp_proto: make clock_select() and leapsec static. Remove leapdif. * ntp_proto: make sys_maxdist static, remove unused extern clear() * ntp_control: make auth_timereset static, move reset_auth_stats() * ntpd.h: remove unused extern record_crypto_stats() * ntp_config: make cfg_tree_history static. * ntp_control: make a bunch of counters static. * ntp_loopfilter: make clock_minstep, clock_panic, and pll_status static. * ntp_loopfilter: make state and ext_enable static. * ntpd.h: remove unused extern last_time * ntp_monitor: make mru_alloc static * ntp_peer: make several variables static. * ntp_peer: make several variables static. * ntp_proto: make several variables static, and remove an unused one. * ntp_io: make blockMask static. * ntp_scanner: make conf_file_sum static. * ntpd.h: remove 3 unused externs. * ntpd.c: make droproot, user, group and chrootdir static. * ntp_dns: remove unused define. * ntp_proto: make some definitions static. remove 2 unused. * ntp_peer: make ntohl_fp() static. * change isleap_4() to is_leapyear(). * ntp_control: make a define static. * ntp_time: make a define static. * ntp.h: remove unused INADDR_NTP * ntp_io: remove unused sau_from_netaddr() * ntp_refclock: make refclock_setup() local. * clk_meinberg: make MBG_EXTENDED static. * replace duplicate S_PER_DAY with SECSPERDAY. * replace duplicate S_PER_H with SECSPERHR. * tests: remove yet another different leap year test. * tests/calendar: fix coverity leak. * tests: remove unused check_y2k, add those tests into calendar test. * tests: don't test parse_to_unixtime() if no refclocks. * ntpfrob: fix incorrect coverity override of real problem. * keyword-gen: make some functions static. * keyword-gen: fix memory leak, remove coverity overrides. * ntpfrob: FreeBSD and NetBSD fail to define PPS_API_VERS publicly.- Update to version 0.9.7+git20170521.fdb63ab2a: * Add droproot support type to the configure summary report * Check for libseccomp via pkg-config first, then fall back to a direct search- Update to version 0.9.7+git20170519.9b296f50d: * libparse: add get_msb_ushort(), with tests. * tests: use the right get_msb_*short() * change "(unsigned short)getshort()' to get_msb_ushort() * binio: move 2 private "static short getshort()" into one lib function. * tests: add test for getmsb_short() * remove pointless casts of (unsigned char*) to (unsigned char *). * Peers display with raw address no longer forces 80 chars on wide terminals * dolfptoa: fix a 32 bit warning that showed on RasPi. * leapsec_query: removea 32-bit warning. * process_control; silence a warning on 32-bit RasPi. * process_control: fix two 32-bit warnings about signed-ness. * onceore: remove pointless cast from long to ulong to long. * refclock_jjy: convert several implicit casts to explicit. * refclock_trimble: fix bad cast to (ulong). * ntp_control: change implicit cast to explicit. * refclock_oncore: change implicit cast to explicit. * refclock_generic: change implicit cast to explcit. * refclock_generic: change incorrect cast: sizeof not ulong. * refclock_neoclock: chjange implicit casts to explicit. * refclock_magnavox: change implicit acst top explicit. * sht: change implicit cast to explicit. * ntp_proto: Change several implicit casts to explicit. * ntp_loopfilter: change implicit cast to explicit. * refclock_shm: Change 4 implicit casts to explicit. * ntp_proto: Change two implicit acsts to explcit. * tests: fix type of free_recvbuffs() * tests: change some implicit casts to explicit. * If seccomp was requested but can't be found during configure, fail. * seccomp now crashes if it doesn't work * Added -a and -k options to ntpq. * Added missing docs for new ntpq options. * atolfp: fix a potential unintended sign conversion. * hextolfp: fix a ptotential unintended sign conversion. * refclock_gpsd: tv_nsec is long, not utin32_t. * refclock_jjy: fix two sign conversion warnings. * Typo in ntpq docs * tests: time_t is not uint32_t. * net_fp: remove two unused macros. * jitter: fix signed, and unsigned, mixup * refclock_generic: fix overagressive cast. * refclock_generic: make some implicit casts explicit. * tests: fix signed/unsigned confusion. * refclock_gpsd: stop some unsigned/signed shuffling. * refclock_generic: make an implicit cast explicit. * Remove package hints for libcap2 * ntpviz: add skewness and kurtosis stats.- Update to version 0.9.7+git20170515.aadc83545: * ntpmon: Add "-n"/"--numeric" option * Fixed division by zero error in ntpmon * refclock_nmea: fix 4800 baud * mrulist: Fix "kod" and "limited" error "Unknown parameter" * mrulist: Make "resall" and "resany" hex instead of decimal * ntptime: fix dumb macro name: NS_PER_MS_FLOAT -> NS_PER_US_FLOAT * Added encoding definitions to python files * mrulist: Fix "sort=addr"/"sort=-addr" in Python 3 * Remove now unused python import * pep8 fixes for ntpkeygen * Fixed ntpq ifstat bug #280 * Address GitLab issue #289: ntpfrob/tickadj broken (warnings)... * Fix a reversed conditionalization. * Address GitLab issue #274: functions fail to inline * Address GitLab issue #276: Tarball should include pre-built man pages * Partially revert: cfe5c7122cc6905365a9d1396be6abd5ba59ff69 * Tweak for getting started after DNS lookup works. * Fix dtolft() on NetBSD, issue 264 * Simplify FDF_RoundTrip * packet auth: remove undocumented DEFFAULT_NTPKEYS. * waf: pep8 fixes pythonize-header * waf: fix minor pep8 nits. * waf: minor pep8 fixes in wscript's. * waf: several minor pep8 fixes in wscript's. * ntpviz: minor pep8 tweaks * tests: minor pep8 tweaks. BTW, this test has existing failures... * Hack to dance around bug in older Bison. Issue 287 * Address GitLab issue #296: compiler warning (gcc 7.0.1): lfpfunc.c * Address GitLab issue #294: compiler warning (gcc 7.0.1): refclock_neoclock * Address GitLab issue 295: compiler warning (gcc 7.0.1): ntp_loopfilter.c * Fixes formatting error, and makes ifstats less brittle. * waf: move alignment warnings back to --enable-debug-warnings * Fix warning in refclock_oncore on FreeBSD * Remove unused ENABLE_DNS_RETRY * Address GitLab issue #263: Catchall for ntpq/ntpmon units problems * mrufail: explain how to get mu on old xterm. * waf: improve test for unsupported CC flags. * waf: Add conditional -Wimplicit-fallthrough to --enable-debug-warnings. * xterm/utf-8: explain need for LANG=en_US.utf8 * Fixed unicode errors in tests. * Fix crash if NMEA driver can't open /dev/gpsx, Issue #299 * waf: add a test for nanotime(), for old macOS * FALLTHRU: another test for issue #295 * Enable gcc:7 CI checks * Handle more than ten interfaces in __ordlist(). * FALLTHRU: yet another try at pacifying gcc 7.1 * Fixed type bug in packet.py * ifstats: fix dropping of valid interfaces. Fixes #298 * LIB_BUFLENGTH: gcc complained that 128 was too short, increased to 192. * Revert "LIB_BUFLENGTH: gcc complained that 128 was too short, increased to 192." * sLog: 2nd try at fixing #293, make log buffers bigger. * reflock_jjy: remove un-needed -1's on snprintf(). * FALLTHRU: llvm 8.0.0 does not understand __attribute__ ((fallthrough)) * FALLTHRU: try again, sadly gcc doc is inconsistent on the magic foo. * FALLTHRU: fix issue #295, warnings on implicit fallthrough * Changed ifstats en flag to be more robust * Adjusted ifstats header spacing * Patch from Takao abe adapted - prevents Coverity warnings. * Documentation corrections from Takao Abe. * FALLTHRU: only gcc > 6 understands __attribute__((fallthrough)) * Address Coverity CID 161765: Integer handling issues (SIGN_EXTENSION). * Fix resource leaks in directory-walking code. * Revert "Address Coverity CID 161765: Integer handling issues (SIGN_EXTENSION)." * Added guards to command line args that take ints. Added guard function. * Missed one! * waf: add check to help(). * tests: add tests for get_lsb_long(). * tests: add tests for get_lsb_short(). * tests: add tests for get_msb_short)( and get_msb_long(). * tests: remove incorrect comment * binio: remove 6 unused macros, 2 were broken. * tests/binio: fix 2 tests, and comment them out. * binio: change get_lsb_ulong() to get_lsb_int32() * binio: remove unused, and broken, get_msb_long(). * binio: remove unused put_lsb_long() * binio: remove unused put_msb_short(). * binio: remove unused put_msb_long() * binio: rename get_lsb_short() to get_lsb_int16() * tests: add tests for get_lsb_uint16() and get_lsb_uint32(). * binio: simplify get_lsb_int16(), all tests pass. * tests: add tests for put_lsb_short() * binio: rename put_lsb_short(,long() to put_lsb_uint16(,uint16_t) * refclock_generic: change getshort() to remove pointless castings. * Test results of test-options by running --version * Tweak to mru list allocation doc * Tweak warning messages when --enable-seccomp won't work * Address Coverity CID 161762: Out-of-bounds read (OVERRUN) * Address Issue #303: ntpq shell command unknown. * Remove the Jupiter/Zodiac driver. It cannot have worked since August 1999. * Add inline help in ntpq for "units" subcommand * Remove the shell command from ntpq. * Simplify ntpq's do_EOF and do_exit functions * Add peer depricated message * Tweak comment in ntp_monitor, Issue #281 * Implement ENABLE_DNS_LOOKUP * DNS bug fixing/cleanups * Typo * Add message when closing lots of files * Update seccomp to work on ARM * seccomp additions for Arch Linux, Issue #275- Fix path to ntpd in provided unit file- Update to version 0.9.7+git20170429.dcab3ef9b: * Add a pivot-related bug warning. * Typo fix. * Add warnings about GPS wraparound. * Revision of GPS rollover warning. * ntpviz: change ppt to ‰ (millage symbol). * ntpviz: glossary tweak. * ntpviz: better define mu and some other items. * ntpviz: comment typo * Fix typos * add GPS pivot entry to docs/ntpspeak.txt * Fixed error in ntpq manpage * Lexically split waf's cross compiling flags * Cross-compiler also needs it's arguments split lexically... * Fix typos in comments * PEP8 fixes for calc_tickadj * PEP8 fixes for make-leap-seconds.py * Update a few more references ":config" -> "config" * Add ntpq's ":config" -> "config" to the list of incompatible changes * Stop using VCS_BASENAME since we really want the name of the project- Adjust the spec for the bugfixes included upstream - Update to version 0.9.7+git20170425.f7104e3b9: * systime: Fix comparing a double to zero. * ntp_loopfilter: fix 4 comparisons of double to zero. * ntp_conrol: fix comparing double to zero * ntp_loopfilter: fix comparing double to zero. * ntp_proto: fix comparing a double to zero. * ntp_scanner: fix a double compared to zero. Add fixme. * magnavox: fix last two compare of double to a number. * waf: -Wfloat-equal warning always on, no warnings now. * waf: comment out: -Wbad-function-cast * Rename EPOCH to BUILD_EPOCH to reduce ambiguity * Remove an incorrect assertion from devel/packagers.txt. * Eliminate wafhelpers.util * PEP8 fixes * Remove obsolete text. * libisc/error: add two attribute((format)) tags. * waf: remove -Wmissing-format-attribute * Load waf's gnu_dirs module and use it for installation target directories * Fixed warnings in ntpd/ntp_signd.c when ENABLE_MSSNTP is on * Move wafhelpers/configure.py into wscript * PEP8: indent to 4 spaces * Eliminate parse_version() function * We already import os, no need to import os.path.exists()...- Update to version 0.9.7+git20170422.4162ff742: * Typo * Fix typo in etc/ntplogtemp.service * waf: define EPOCH=[build-date], for reproducable builds. * EPOCH: remove REPRO_DATE and NTPD_IGNORE_BUILD_DATE. * ntpcal_get_build_date: now uses EPOCH. * ntp_calendar: add missing return. * magnavox: remove last __DATE__. * EPOCH: remove all mention of __DATE__ and __TIME__ * EPOCH: add URL to reproduceable build information. * Fix const warning from FreeBSD * ntpviz: When Peer Offsets has more than 6 peers, place key below graph. * libisc: mark two functions attribute const * lib_srtbuf: note where an attribute const fails * waf: remove annoying warning: -Wsuggest-attribute=const * ntp_filegen: mark one attribute pure. * ntp_leapsec: mark function attribute pure * refclock_trimble: mark one function static and attribute pure * libisc/assertions: fix possibly uninit variable.- Update to version 0.9.7+git20170419.bfac46769: * Mark alt text for the ntpsec logo image as "alt" * Address issue #268: Waf uses current date and time breaking repro builds * Added poll to clock variables * Add step for testing cx_Freeze to devel/pre-release.txt * Remove useless load of bison in waf * Tweak ntpq/peers printout to handle new DNS * Restore cross-era interoperability via pivoting timestamps on build data. * New systemd units to run NTPviz data gathering and graphing. * DNS reworking was not 10 years ago. * check_sanity() is now used in only 1 place. No need to keep it separate. * Add Debian Jessie to the list of GitLab Pipeline targets * Fixed lack of 4th digit in unitless display. * Nailed missing clockvar units bug to the wall. * Add configure-time warning about 32-bit time_t.- Update to version 0.9.7+git20170415.e3c051e3e: * Allow exit if no DNS ntp_seccomp * Attempt to address Gitlab issue #257: Warnings with clang 8... * Add sodium installation to buildprep where needed. * Improvements for systemd support from Tomáš Chvátal. * Add instructions for setting up boot-time startup to INSTALLL... * Address issue #239: pylib/packet.py should get key file location by reading ntp.conf * Fixed ntpmon crash when detail mode active and peers display hidden * Fix typos/grammar * Revert "Add sodium installation to buildprep where needed."- Update to version 0.9.7+git20170413.25a240c2e: * tests/decodenetnum: test for /etc/services and port names.- Add netcfg dependency to fix tests - Also require the netcfg as without it some operations won't work- Update to version 0.9.7+git20170413.c3e3769f9: * Unit bug fixes * waf: Prepend, anot append, computed CFLAGS. * decodenetnum(): return more error codes. * tests/leapsec: stop mising bools and ints- Switch to git snapshot for now as we debug issues with upstream - Update to version 0.9.7+git20170412.f0451c5a8: * libntp: fix format signs. * fix format signedness. * ntp_control: fix format signed-ness * test/lfpfunc: make sure printf works on 32-bit. * oncore: fix format signed-ness * refclock_mode: fix format signed-ness * jupiter: fix format signed-ness * Formatting function changeover and associated fixes. * refcklock_nmea: fix numerous format sin problems. * Fix two format sign warnings.- Do not use %license macro so we install on 42.1- BuildRequire xsltproc- Use internal waf so we can build on older distributions- Enable gdb debugoutputs- Enable mdns- Switch to python2 as python3-gpsd does not exist (by upstream) and we need those binaries to work- Require python3-gps for ntploggps- Fix python shebangs - Try to make pps-tools-devel included for hi-precision- Update buildrequirements- Add config from the ntp package ntp.conf - Split the python module and utils using it to separate pkgs- Restrict version on the waf that is needed to build this- Inherit items from ntp.spec: * Add systemd services * Add logrotate file * Add firewall file - Enable testsuite (always returns 0 atm, 2 tests failing) - Create ntp user the same way as normal ntp does- Version update to 0.9.7 - Cleanup the deps a bit - Use system waf- update to 0.9.6- Initial build./bin/sh/bin/sh/bin/sh/bin/shlamb13 1526319203 1.1.0-lp150.1.181.1.0-lp150.1.18ntpdigntpkeygenntploggpsntplogtempntpmonntpqntpsnmpdntpsweepntptracentpvizntpwaitntp-wait.servicercntp-waitntpdig.1.gzntploggps.1.gzntplogtemp.1.gzntpmon.1.gzntpq.1.gzntpsweep.1.gzntptrace.1.gzntpviz.1.gzntpkeygen.8.gzntpsnmpd.8.gzntpwait.8.gz/usr/bin//usr/lib/systemd/system//usr/sbin//usr/share/man/man1//usr/share/man/man8/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protection -gobs://build.opensuse.org/openSUSE:Leap:15.0/standard/cec3fd0878691d65e0e24a7de7e5ef73-ntpseccpioxz5x86_64-suse-linuxPython script, ASCII text executablePython script, UTF-8 Unicode text executableASCII texttroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, max compression, from Unix)troff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix)troff or preprocessor input, UTF-8 Unicode text, with very long lines (gzip compressed data, max compression, from Unix) RRRRRRRRRRRS${滌CCpython3-psutilutf-888feb7e4caf44cea94139441125c583d1a18d37498047dcab521f5e5aa80d7d8?@7zXZ !t/ q] crv9ud5?!]p?l8|rD8|>eDp^O̗JlJyJ@-bVn[0::ED^(s5݇v2&4-Yӎ.S.g]ceMۣ]X^5%k٪ѩrybDth\)NzM>2W у$S{G?Ql(yXE9cɬx[f&׮Nrh'Ȳ7 $+KÃI%MDM|4[4au i u/8\^ah ;ڀ40"؇tGÃB0*͈ߟ_aӞmyJ9pu+=]5fkrʜOmIbC: &@$C>2Įka\fb_L QI}s0[o9OY`u4lb81[9!fǜϲ ㉫`xRBb%hp,h热CzģD1-+.FM͆*x֓8nBQzd\M3fl3ncyvpQ%"z`jҨ8CzpK\ʕIǴj1#8 ̍XTn`v&2<~&-_;1v"hҬON#)Ra{M}$/`cSMaao[©lT2^ڸwգ%ܣB+}Hpq l;iccH2U0rf6E뉚3 5r*pJiހ} qc?G|)#5NO'#ND)` o]$`67d'0JԒʢxH38D d9.R!VWǟ Z41&; 8,0$7^B7JI=MvT)vNI=|zC:kx<{ې=hM64)3CG?N,~uyLNu WJna &5[glGߓzBV qlC[A M/9Lqv5J`="'fh %~>MQ2`.vdΝFP|k9ͺ$GSȍ9Ll<(u¨qz&\EZP-H2 ԶE%U*$73G lSv=t_wFnQd+ƃ0!~[leɪNXRER{ :e|2ş|÷s5 VtB:FeN +^:@fNEw~ͭ -\\zylE&)8xgǣ"]xo8 X8-_jP1Ct+ͳ^اRGt _U+ɞtsIdkC%Y5)>0]=SZYɷdzcڋwGZĄzP#|kXZa2@0\Y HKTH[P)/ IV{BQʧӦ^| 5z :gJGPX uk 9l=ґ T>]>Z@}"9 7]4ħXx7ɚ&I"==+;Sʭ("q59٦A/DDەطMա_A}Bi??Sc6r[ےy$J%fc>[ЦrUO6WDMv6&υ-br=} cM1rN>Pfwi9h^ `Yhցqχ-K-}ښʒdGIarm6otTi}K8Ud7ZpE.Q;(\8?5b|Yѣ5EDTs cQuL釈}m'Ђ!CO/{t3Q)f3.6x[5v + ~nh6dA k Lv}҉kz۩i7D"Pmd)J +^dp+q_q~e{+#JR.*CϘ1,ˊ9-5`ep R޼7~3=衰.}c h3vn%Q$ld\!p"㷼#b. Y^p>muie/Iz;11 :5M"_6o> ʋ(2ˠ@]U8uJfZL&Ȑcs 6l'm5XZͲ!ղʍ1\Z HB XAIy'KGW5ͮ,I~F+wBJ:#8>[+% Nkѡ'>"r>u`r>/ 4"4O8IzbjMQQ|n%VF @4QgoveZ7hG;i(NIKj3_E!F C~94RO%4q@ oF Gy+ClMտ/4ҩ(9r8He|{0,Zx39 :<'*VfªX~))/YmUwUPʼ9> p=D37@Hƛq~eCl@ T~%ҡCja-־kvptT:N(4 zfM* ݑ'H74ڏ,ch赱k.`Kl2+azxSa3Ifwqx*G)mRjCMܧZvk54(t!CV*޿;)-{ΝMs=UiAto[|%;gA7d^fd#% `|?CC`VlJ$m/3z:3*J~gUџYV9b b1z EU|aѼqKZ*4d߉w V.Ahb?X>蟶Lt_B#ςb2;URndbi9~:v>^5 g7sФQkYwk;O˔+_.lǦ̈7eKՋYr=J &H2ϪځB|*2Zf됥~;hp Fb"=)`7Ֆ> yg&@#$H\%6ݵM#Ɠ Y`)NdZ=$rv031Wםn"eR"Ԫ' ysy;*Zרn/ߠFq!/c{q}1jNȑ7O!rxByIǬjhȾg;-H rErFAI9~R?Mn[K|E3)* u^;c_Y}<@y:@,:@ >|ܙ 뒍],6'UYA>c,E6եaɪcXq%eqc/=aJ5[5@I1`+2J03EE?*^J{F"@ڼN&J?ą[5E{-=,$5jqUhsϟ,Ner|?ɓ39^5 K8%h' \ɢUS={@Snܫ7*J)Ӯ/U.ksz l65 5kѶu$/HvW)KDr/M3^x9k+9; 9ԄɺWb![/sILdel@BN :C8bЋv,a6o#X0MfkbV;?]Ns%1{Yk(,GaM ;lԆY ~.w%[v-MZRk +%oUzD1̙Zz1eŅoLGcצg`%{+.Y#zG#v`P7 D曶FPY_,Wclxox߻&l% SàvJnZR,ٴp0Y p . '&CU!K+{܀=:o7gXhd0q6듛"b||MwCCfZc҉[?=Q.}J$p'mfXc8?OnzݗN-hX^♻ hp ['e4 fD)(kw7y3v]c٫0opסaO֏Bgge9rMNaYMu\cֿjv(ꄝrzཋs@^5s= ztr&:<9~ދU:xȡCKJ5 H5I;I̹GG )^r[MHѥpςh,YҚ&.WѹB$kɝoR֓_54HRSRUf)Y+ැ!QdxjPl؃F 8,{j2Gq;!0`aig(d E-(kଟdP|h%z}q]-g w E1` t}A\3Z goU JtGжyb:H50|찗B>#|AsN4H#^:'Rkn >!/Oa=w[,S$^?Բw$#^{ ?6ϥbc]c&\$*P&AB&t9!{k-e{iXqCF kh):Yt6N_s&kFS20[u'f2 ^~~!Sr-M=ʗ":I^3#Ym6{W1bʄda)w9blbSTq+@]+,HD>]t~TK&] 9lđkai<3302AGW8US3NUJQ<]l|cYibDrm¿5XfZió*Uȶ%Xfj[k+}Rݠ~j߶Jy?$yFmc >y*"&VxǤ8v`*Ȧ09 :y8GD$/!=Lx=-KnGTk4M1'+.ݍ1o,ޔr{kn UۦSlk7kr5w3΢6FWrw"텋K{a> zV{_ .Ayz˒*Ĩ#dnQ`ߌ:z5"aI9*)IGrj5N-{ZE8$a-iobE[G:qKu,N>+o.^TOW.u[4;.W]t>ӛ+$aLٖM7RQc="6y_ꢅ P+jE]g6N}7 3gC̈́Q+ 1ȻqWS{W m$xWMM좢ۀhef3W:I} Rqm'n\^3M#ȯ0PMo@1ϓ.iI1@ピZwB˶7]@sœJdnqٖ[b&+l 0 [9"؞&< Ps9w<O`'Lwk2C鱝٦V.=MVC#> p7\N,j4a,wDqGm)MiQr=PKG no?T[bCm]}t-! %[ Mi3d{nK*{|tsB_O!X6Sޅ+Dul3,)%c@#}f#1l>p$]AY 2-$K6y)w9*6Y&ԃ5o8Լ'-2ݝ:-_j? Uŗ8j-(Їk~QgVMdybI!(k݊kD`6U^^Fz 9mje훜  AxYgM Y;8szUq )iP=p rjq^U%2i`Q߇&DvGa W }PuUd(^? -U]_3ˌ^2[{*qVe]"vùG ]}ҭmC2-+ϼ\งV: 4 2p?>\l2ܴM/\V4hR1^:j~bIZ&_K_Xu J_k<3I5%ehoۮ2͐)x,)*XҸ QWP"ۑkH?(啈踯j+ X_GƂ` AvL2uyS{M5̶0fXjoP U- *(:^CƿUa: !_`֕3/*rk-xP.p'CØ@'V*4BQm{/lK2;x 12EWWR%Nh8mP{P}n&a$/)B41H>fYrtuQ] :VP^YP̢Z HXV"yx":B DTqtwD9ˮed_E؇O'_#͐HRgWPWԶi}KI9ك^sN}@硥KVKā2w>+ {w|X߉9ԃ*2; t sDc*e|΂RvLbl&fb%c.n?St.k9}f[P8ُ ef%Vg)?qXz7xJ >a[LKzеgUNbOxi$̛9KAQbP:X#cG]!6!`sv @ 3$oB0/η C/pqS Ƽ7]9-dt6nov1{ _XXKg{#`eސ ;1-! MA'Õ,s^O%uժBGbj8 Mni%#M`㯔J}YA7$xhcTKz]% #Uz&amKnO ވqUt9?vs2"Td4Bu:-%F fTT b0O#RdL[3z2#ljӛ 2cLjNݮUF@ l0 T6qhkdc0NBspp%"Ɩsڟ_4.LT R1ύs7t"ζ ٬RŮLЯPhmᯍ<γK̃Z`zEYCx% m<}]/Dgi>:Lp c`vr3%ɤׁaJbOEu8I/-ә $c6qjv0 !V9J~@oCܴʐ-X:$AnݾRw{}@Gg\% {`r.*#y6+L hdKeE[D t\th rA"co.pp4}|\J$\Ux E܆gesᚆuGX4濐 n؈ HIƀl+OoWޭNޞh-'f &$wSJ̭gΥ,i]do;b 5W5}nuQS`TO0x-{p>[.ɣ:N+|E0 oaQx,&t"x8ڱJRʗؑ7=B}݈- =IIW3A.lRLtdX,be6Qy  VMd81\>tu)}ݴ%^32{ܟ誜R]cm2-8hzD#$Z %A0{8أw p_5֧)6g]v$E1 ]hv̐i,9F)XX_+Fgcʜ%uT2o[{?SBZ Bz /Kt̚?ȁpn4ϥcuY`%'j3[Z¾H`Zaa">K*w}4q&` r 0|(5ʢBpb⟬}p~k@׊rR74 tfݢb_Y [;8aj![4Od$d&3J-@KbJ sNR1FԘ1V@AV2Gw-J#fifdoש4b%(д*+| ({?@q'@Ǟ Xxȝ;:5@ڍ+j2mxW\O(,X0$~1Ò7Cf<I-HJJ/av.'ul`b#g4|g%&R \&HtRGy#&Tb\7] uu{T@\s>4RA|~$8X*3[jwqByF${TǶi4A}.U(7 溂}'F"Dg7A&=6oS#!jU>0#S"oD^Ѱ!( P;x{&~N]Im*3.J2Q\*m"VG+Y6uHlJ h_Lwyi $d`Es9":F%A`S*xC*rPW\U *]x?x|_ٕǕݘC ѹ{sf1Џϸ=N󙘴2l*Je!7X''@l#ʐ~ nqfw %$-G?XiB8 & rܒ~~;*kE"빯߮zCxX0?|>tYP-`GuaK q\)ו֐~ROFzzV}d @ϐgG#l~->Sfj6S9OspzSOE_U kW#W*RB m)V@?l0#T'CCoSR5OH$.']1F/ &"W]<ݾf@ j&qh'btt#K?;AR>П*n1m䯶;9%UA҈#ZIH-;Y?Vl2p߂.O[b~4$gs;rlIj6~$բ^yffQi l܊)(pW~y7"RoF|7D7Wyh*`Ꚍcl(RFu+] PE%'r&{1+N$\Q=HML,x hnIIax́^&t4)v!=__!\??Q$l'k.dlVֻ$c )f,7S+ mӛ3Ps-7JOˍ;x=9PvX#ea~9t@vR+ݤ~Tw;t|-3rJ4eoԨj2*T<VT.ȹ»e%)X=/˅'_ۭpo9"e"դhm: ^\M l7+eOk^.ٰbcH>ͶWOyn^'7X6&"IgeMOe:Ntk\_&Drw [eY !E^STH)d BTDv5w#2"d Z3MȒњA-R&"p<9N%J2MY7~ Ef*9~(Ĉ8%M)Lﬦv":!n6UjjX'4l>BQBBhB$-2xM1l=ߢiTIPG]+=^JbĬ^'"3G uVe)5^ؤ`Qw^GzdlWfΔ1 /xMޫ͘관?][) L OʝbU6ADi#4Htʟ߂(^KkSJ86-8caw !e},OÌRʎP=,2JQM晶HYT-Ђr{Ju s1,Avjiy7 4g)b֏'Y@C{p/D)+L [aسw #f"u@EG%S2jDaLd=dћ~<-9KS~57 @lk3 #0;ӷh |dxp]ֶug2ơ:EkSU[E2" Ml/s޽% nV[9:ieLL{ :}i08#<ɰw_ y8f<㓚*)fҩ13h]ܢ>֫3) q0uG*&ˬOZrvIsE-A%:ɺJb'[,` + MܓXvP,72zdVn V4s[!݋\1҅Pq,_-#ĉ KNv]ӯbSŖ̖R gaNn gj]?R|$dlˆxvzL2U&E!=cǸ8w:j;VlJė/(|dc 6,5Vv矃O!mbׄPK4X PעJH-i-Yv_QwQ%3Bvt,Lvdz~QT7TTJhL'pѪv(ȑ48έ$oa@9s0ު.]_6%VR6*o* Xݲ꾡Kn$l89 7$'~}啊$H\NlH 1BN=6 i7̄j䣀MsnVz}2WyPVmI ՌǀA\UǷu[Θ-li|5M j|s!̚H8U<.+AȡR<7>i ǰZ(4fD7_ӆL)necӰYa(n\k=Pu@JaX.uhT|>7(̈́{[kalIE )GM-c1j%˩7~dSFGuy'}K_$b :qEL?f(ޓ6M ȂP9U0~m"gn%ߺ)y؇n 6>2$Ym?5᥁$$`f^J8S ȉh~]lݼ_ |D[)n /r"G( P^¤ϭtlĈUM#`5&Q jDrEnF1M>g%OTuO7I jeo_̻Ϸ:zf5, ڵ0&!9{\{j^Z+wEtk XT1Ek)we{gI?GsDOnbF'6^Իf_ū|< E>Q^lDNT"d@LBm6; st[QVe:\;M#oȩ)fQisu3k?2Jb H8M ѻ?*iҕN(ٔp!W}SŐs5}/ E XR^EEK3ůoFxۜċ1 dUkIHG. s2|d6:_x֚!#:$n;c@~rMªiTWKettKLE-8[ 4j<7-:xqYTBRAmb/^~?CYc+=-"`t0\&ڄd+;ڀiRǎ [1Z .Ǔo'+`HOd&! +ChjOS1'vb%^qĒ~n>j|J$j+ {"Ak'35 la6*$O#GkfL6}ɟ,6X~R8ɪlrJ"rKI _, HXV~T"ffX]3mor-M,YEnV%}QVgʧLW>BEޮE>Ak v\3 1j#,Tc 9ե2t{N;[pFq+3WhOTݧ{(TRW#>izkP-E_vo-Y ԡ#n}]q -`X忱ЃšD8֞ =XPWԥKf-!Ej`ւ/keLiF[KˣÊ;$;;׹% O%JTo5WFi@~'h/@˪7ŒahmiŇ-y!變0LWZR]Lv';nRH7],%1-mygI格OO+ߜwk~kSa7"kc-P$Q8%)B]Y9vf_* 8æ'[< /e<Ν(E:CK-z݉W㧟?GxX;%󳋒]24O~~FqeQ.ZEW8BGtCGa߾rM ."h|CSD߮*ńQOjr|ʋ |+)i0Gg05q{Wj3yxl}&FNʻ`ϛO| oX,/^].\{3j nlon`Ob.>!8y lrPK`d#VBaM09'JL*0P "lգ!ϠԔ[Ί>DZg/n yD6ikzta0{,L+St@ߙ_ϻa >t|΁ §יTC]b<%p^n_?3@b $x ov-"߭h-}&7'V=}K;_ܾa`N<$EJ.OP0C2ζ7f'd .{ H'{Fjgyt?Mh13ɒrGGKrC4$Xn$E,M9+n']6؜s׵3Y֊,BĿp)yM MFO hyZ)Y{X9g  ^O .aZ}BxV8ThG H%l?1o@U6O#)~A}(`i}]<$:p3V*?PZ:qEqlrG"mࣶ Eivi?#3јJRO&;ԿUW ;^<|`?E4BZ3T_h'oLǢlצ)A1&pq |qMwIlJ}$|A6HY̝ Gŧ!#mn ;-``g\?)#" T%I٥gHASA#8.8b ظle|Y~B3Er ē "fAq =`804J7?e#WhםK];5V_Ͳ-zc06j:,e7i)Kw.S}_.ǐ12l(^E~sa6ՂYl}8CTGl=>L_WUv !# jF+eS|{p=p߁{I6v:#Q˿htډ}$!ICX^0- fɾ=ش{ēT0oB*Hv]fvOdI@B@p<=O@8B5Ƹ' v.i8+Av|KA3j2IA{mI#@庬'If6{ݐ^BYn xVļI @Ƶ GPxdkuGfH9wY@f)`#-HcSbGbi$V K[iW)!>I}2PCnGJI[<<;6ɂn*nOh8zֺ!o%!O*]lmvVScwrÜnӜՋ_#)f7QSlNeK-p]0~3V阢#Rkr r͛6 GuΓ~䵄|(\F"!_aR+maŰ<3I{tv  [7\yX"6y?eiOfԉ;# leE|<-v!\gQn.9(ʃ3& >"{T'3f VNG_Dkz/d'ϔtVo&}ve3KbOr25UpK&vvӔoܗP1j~q90v8i?HsoEV>]aH+V[VCWz9=0} ;OU6ӗm.ty:8$5Y_. 4~H, 220Mh$%Uc-MI`y_RxQl\SnGwMA8EîfH>q 4v'QmbfѐY8,ݬrgAR`ԣ_5ͻ ,et˝kHhn-ck$|/-5P54{@m>?N9$uʭ"HVw j!/ʚo y&Ξbh\I>(Zn@O[G՗3]Js%?p n{;'C( WlT?7n/E7cgPRkAmmUvKzOKN|ƚ-nB*1S]T Eke@S~ELFh@#;T-)A$j۹+6鶷?5ubuQ~"sSVMv竊]v}Im !g7Qa1v61ff]߯+Cy22ݲtSyp_5T=FyV¯FI=f'f4:љl#i/'?YNs),[/˳A Qot2_NAzHoz?_\Fi%Owϵ|qȰKjHoDgd ]*5 ?^Ӏqq0;V:-l^{aKkp/,LM9sC$oKP]oLӜВ`!c̑<RF'<gDy;t#kKʊK ?'\U1lQu'!oaf [5j#]r&=,($H̎6ޏrpt(0[k+DqNdTb},reP#'^GASHAc:nBA}ZJȐN^ hhuyR]p"!r/( D0[YٱjxI˩c/&(3Ǎdg;oK]~Gzx a}fpID$^C5 5jzLnܗ2k V*⌲-RN'i?: Sh;2.׼`[ԟhb[Dyt˾0{4j(owWWEK͹D+182muP^3n Y-˭v"~jMglvUebpq2 N(*!_mY[_Lns0y~ [PuDU)NMI@N .G>\B;BET|r4R&9mJj RǏhAAf`Tyʥٵ=|fGgv*/6k1eӡٖ;pv@D\і^6x N6ٯB2@sf7ݥi<$BbpC՟¢Z =i[[;bb[DaPUlE39VهfTu+ 'C~oɏvv#: ]wJY dG1ŤS}b- =#ϫp\O8Y(ӓ3GuYy7/6(OWNH@nvfǏWWB 1)J˫ˣjInŞd!4خ)~߽st#| @C?ʥMLk(h%51d#?aS`]j )dvUyڷO[`޽{w$pBԥҘߊO /H0l48y'P8 P,9B ՝x_:Fg}7#77Ƚ:Eu LǖU]A&ƭD3YUs2zef#v23UzY9 C&7ד!} }!_4Ypo9 8ţw5jzZEj.+ƭ$DX|@,% ͊10RǨ:,k陈f?k9V TFUx^!iFH<j~/ %RBesX5HG:iqg%zf #;!_I=M?g !kO7D`y oo['x;ْL% u5 >gMLSᮯ{Z`z^t?4GCa(4ôVkh{0%C}69_pE7"UOk.H{| Y@~/pw}ͱOMPqN.RJ lU8f38M<וG%H1ӎv\31^DFِpK3l:YWD% NZ4/N|A,Mm=q5=Dɑ#$t[:焓u7$v#]8_3wa~9G `.nMyq&bmOH\ ,tg -0c+[fK4IXPdH0ۡ'o3"^'>!ӣ\-*=Xf\ldWq(FcuU92LӨ7w|Kd2u~氏{wULn䧂W- lNqסW#oUAH0)-ߎy- Yq֔W(>#rG 7*[fb+{>'\GMZ)[>Oj}@}tQ |w><l'Owjn}!Y JH))0dkp*99XjGGs>nFhnw+|NB4cMpfTy fvB)GP> , ^8+㮜'T Ξ˙ȖrkӐ(}9OX1"5W G-+(GLuM=''o?n+榨*Ksror[̨ȱZqdXTE:F y(h/\KdoՕҘ{js+h@O'?p&GLɭJQiS5w <`~&kdVċ ESp.:w1 TOǵK|N'۬U(8A^8HgĿņD=J+wq ‘Eyb%Xtq^O8- 2n GjUWoi7QI):[x$-}NGejޅ8e[Pmȋ!V@Rp{-7qZ_.hkڤ+pD#j{ F z9 WDЗ=X8̖7dÊWo蠽w (FJ #L x)ʷ$-a-jP%;.?A!!|8wv<;hӉZPSү{"WU@eB AޑH\A"NeWep"mȲе]\=1 aCNa*81vv!PJhV;M "b#80zŊ7]x;Ut.{xv`u8*10jeS/x$7 kq~՚0r@Zs6 ;, &ƒMx:5knNpJ;`<++ReM6ݨA*Y@!g{ V]DaQ;̼RJ˙7@h@ ޏ̟M1N,49pg5 ԧq|dloBI=R|XP z҆2N'?;jh]exN%WU8`8[933 *q\[մ#VJk$9ƛJ'a ee~떗`GUh4wǢc/l9\SАA@HS5Ǿx 0" 6R7lc) [i;%;*18`,Z+s &Eyq9WW /Gř1~-P3bqTcѷEqs氾k׬j!f^pzF$,i+aL *@Q\y AgnN4e,zRF4,N`(Jiճ+ۚӛ#/)}=Rn}E{0 ц@&>@&`Ρl#anGaǯ-gXO9#ё={f5(3G*m 9"_$ݙ;o}cV߯5NvzM͔r- 's ()7ɻo( G+uDTe~<>7V6.~nk<@5f0:e5 C u,.Qs, oK@*Mّ[Nfg,f h:fjkZ첣vka$e0Jn-&3^ S"dqqL\+nZ ec|:Dwb%ebzw_lW]LɑyS' G@UJOLki@' 9AX>y }!z g~IWjG?VdQ"tM <& 5= Bw I۽<$;P\jhMRf~Yܬ;j J* ]4,`{Uu\]%6Jx{g1sIMW ԑ@d80zL`_-n, >tp"2M47t˸>D\'~"S) A{nm#P "paongDV0[F8 NqciCxʷ OR3._\=P2#4 ;JI0:H{ٝ,5`0`.'E5F02i;n$[5~Țזf"m#U{ (,Z.RI:S z|EPjVmDv63ZRdX1oN^(=\:[ /81V~W152g>8W{d@c_{<\]gl[&e:։=hE4vBW#/^|t9lmq=A5>bHuy6l<{r0]f\6;\i*FՖg`(0s,*$ў`0Hc1Iи̟zS|u->dt.r øQ*qnu[nA}@'\ )k"e 7%!Dk.q m:1dzΐQfo+ߐHI}p80u({"G'K|f%&c]%L|\jϪ#/^6w ;E*G4ȃwo0bv 1t-5D̛m`)\t뻠 g"άh\b !ʺ݋=02:wbr+tS2hk $(Y ]]-Qwِ8) s$wD6cdFw't*Q-U *F[zafN)iI3^ǭ:g^6LLuB~FKѡRWv"(Bo7%sx;]>9[ 1B8;?J g"afg %P胅ʜO !>Uk]֖|˅~Ɖ!Q]iRjw6ct#n]ߌ‘ġs̭ho<5N;OdWW{'O?) 9,Ģ+8l`HǖV:O,5n-W1]C57Aj//\ T-voi 6Lo1|!- Ξ==ZIŶ=5V;*C7\l0tx] ܍'YRmF}\e)'c{ j1y,װ#OIp3v(銆7 04?XȎU.荟z9ML~XAfU|_żBY'zpi^l6' ˮלּyS0’TaŪd9 d?tu2k; y+*tn%ͤ 3^!O>Zr.n0}ˁYLeeM9=3x)T:Qs3yIHa?FH#n;A8y4f4鏭(^WxzMh1#A=1EjĶ,#xO[gnS}wj1vU8 Rbܕ~D{7;*.#uOlWDi8~'o#ί;kc xJ:Q$RkDw*Ś6 'e3jZҪېaj/!@|0#ξnS80z-4=8_E,~*´MTdCB\i_m1JK(y) wV DlbBt)Ҏİ]"@TKķ\m89OmZlg:y;Tz䛜ЖY7si/0?= 3J3!B\|0b-CY-z{upqN9=2J=Wpe:|ldG:Up`#FiH Kܰf(^OE~FA7v]-ztڒt"%j8닼] CKR$ay2˦ݓɿ@mlhϫ (Od6WO@})Mg qSn~*epP*1ru1s<1c`4 e>YSǼ]e} wle]*:`9?|F DOTnn++=~Rn g@Un1B8 Q6EyV48(]OƤt'gpM0`b/r:Q@KNo$RE=GVG0G 94? 19e%WUw?zLLM0fc,ztPWɷ)YEE=-e^zPSt/j,$"ǮK XPFӮ%u\N&/t*'r!>#ZWnN˂J᳖Q l:)I,pg3B{n&io޽8&ȅ`֜gL;,`>@tˤnuU^KzkY\'§ӆu-\&^ͫpi-$?P$Hd)`׀Y m)թ0D*i4tW!MSJl&^L#6H)]g5 'vpV860Ea~I.(R}S1"؂[%yBn[b^2R1.hzHޚ"[> Y^ (p/AcQwBJ*Ik6dc'kqwB/X|H|JCJj+%!\dxޱo?=4VX~Lwqhz9Q֏+=ծxWwGsAN8]/Ċr /7ɚ4`=.F.X Ki%/У~C]Œ{|)_kX5:x-MGy];Д9"@7zQōc`z܀P)hEM|E4A S_CɦbOOeb{!j InʸO*'4^$þq2 Y4G`*4w & j#p.nJ&!DDfrHu%2T$:#bB!83'"ڪF3!D vbС:8HSV"OlP.A/6h-K7]DKi78Vaȩ1l7Gt.Jǫ(6v}j}|~#?Pc&DI g,A#K%Y mzp)ՙrw`W[rюT/!YgQZhfwt]͐P `B{:&+8՝L%\h6:p^kyհ= q\s5q&wa͗ ;(/FqiMߕLBJ(U@p=%KkFDh`,""%$@r,WJT{żIh:LjƬ5 haRy_`z%[GNɰ78s- <~ލ9Eo,:~̕ʣN䮆'}3Q ~LǡLȠ'l̿xE)r*I愂Չ aMBL&?#=Hk;fiu-e&ǎWgv*bc8n呢YuV;Α϶B^C% r,! 1G*^^/W @X/EcoIswqfReA1b}c+K9 s?HXjF,D2(-w9B1€$T*|_SA$J^vcmCfJ#JP?/4FDA'ĉLC:SjN̬ 9.H"yѓ_L/PFA!HF/9-@DLR=xwdUv}`>p sėD!i"{r(hdgyt`)JnLI9 sm9{j3]-K˜[eKImW1q!XDĵ\)I;(l,ǃzɹ 5~ H:Att GC_4.@E4ufKG_0.&t)$0Nb4gm.nR4'O~p>8~c%l<=WrxЕ>yR[bc)ԟ0hvܨjX+"MI,~aAffu*͆ڧz_}“Wco w%+Sԅ 7{ ޻2)iPXw)s7B^aTH~%[ 9I0 DWڥf,i>|qdlԂRwl4^TXCȴmrb;_^q@A[f~tP%o7E*)cfRF{#|76)Cd@鿈|q|\}],'=CK`8kI^bn鐌:/3f0j>>^&?Qs^FdUM2𶾞&Ӣ@⟄߿G#󒖝ZE2QC(j_J %#Oˁ$ 6p#Ne9ҽG3X6M;bы[ZDha()es@gJ ]>.$Z}<z8HЈX1wZؽJ*i@9l`'ylj 'e o+c`ɀM1Bzl4d2SQuoIJoaϋi 'R],Xp6]nJ $ "dȊDV sZxdqq pV+y\b=kߚ\HIgX[Oϼ7hb(GcAەkCt胎ef% 1K 1XmDk|nC&s ܷYxtHx?쟤F/D*݉Y.בYBϚDݳ Գ]fgrVOfsL/ZS$zUS\s>zOLM1x[N: |JK ! @plsۮ}GrW݄ׄ\ovVl5&JpHh73J~oO΀M9>Hs/ӊA<;VT㕃 GQ9eO«rfg M^5 Z͔֞FeVr9HWrGkr®[:X]jZSNjŢ졨zqekr e`5РK̞K}73EEO,\u̯u0+lɁMg%#ͪ9[׽^9}> a@v=uŢ2a3? (o,wK k ӌJ\엄? ċvvi*U BuF6<{>W&ZAJ"Z4bȃ[ Tg#46O+bW,@tVya- 7m |ހ7e7,(v* 1{f$^/p@50 w#=Qm ȵ__E`y68 l̋$(lt8/g#(o)01 erv^F1yCٱ%-ALK/T-3SJp?pNW`4vuaʃ 1U2C՝+4L@)]m5_B% &Sy'˽E/z_uUm;LV*]Fky=KCUjiF_y={|3D` }N/rĤ>f^ۻc*lH'?t_"-*Z7HpgRiKI2%4#4{{ <*̬&XC8J,d=ep7V!lTWj`_+%_zDGHq#n08=ٙ;4e!ЃW }sa1A4J6xͼAIn>cw7c,-T@5B" ;cWm=on&1l+B%30Gj ͭLZ<`@.ug۳"e4R*R͟#LSt SP%Ζږ5v,``aU5!W[|Zcc$OW/Ai .AA]iaO4`:yqWo ֙WD?K$[># ͓<,=tİX(4>^'4&Ub&tUmnJVLjAjFiBpOc0*w@M (fYOi -SRB;L#`w/C KkaW,O*:=Br<Z^O68k9ke8mbe@EZ}ѽ ًg_1"}HtŲl獴g4D;gYD2]Ή#o]L415Yx<N6v9>SpX36c5?8o% ://x9Npm' *\b>V9:Wc-g`X[+}/ŚR'u?(g"sz7揉lG1 Cޣ?Q01B*>\ty' ӹӾo{Vuw^{4{dџ>k0Q6 2J=\iP yK/n]\xgT@Ww?ϒw;4mmR֮ϵtEClpQ~ C]%rO+e+T)MPL+ ~NbB)&k?=T19ԁ-j}ZqLA#ofK Zr da_㒊2VFNG%X߆K&8.ݣ p9ƂUxkVPDin' G/Ub܆VS#@? !Wӌ[G}N>1Qnm spMYS~3mZ%*mtF2 {<ڻ`N`ɔ*@@B ư$v#S6Ei0) FA%0#1bڟc b"-0e}; ׏33X)A+`I|,l`8l6zοF=,XӨ[uJ]O n?nB&.:cںYlҺNq6ʃHpJǽNI#_K WUCDy}G, "y@PEU氃ȃaWBE8Zg)*㺆/N]Wqn3#މT2 }!"׭.*G8`VF]7 HSkZD;ke^ RGZ).'1FD)3XJMY[B ;\~-g2rb pYVMne<ʉdR~@x$N$1Ӵ>CPKMc]rOhʡQs/ROtIr U>{/Ɣ˜j7[NPpթc" ȟnI:$;mБ9qzȇ81|]"*{Y€(;Rj\8r̲ٛѬ2a~1GARpb ZF*6Hyx mwUeڱ`/yn H0{$9(%v!d z~1i%k+KHWK ڜ4]ςn9EGU;% u%7,/AP8o|rʎ͵S;#Rs}_df U(! 3EPY}oِ "v,#%nT*BZ_yE3ٓK? g4fFCDVlUvU8}Ҁ)5qLi }W ̇O*6a{K3vWz|hTTbz/꺝q! :<$;-*jZed8[٦@9܆!Y-fR_$=f!:9s}ҸTI"/b>8J83=d CF>-yo#߾=n}FΫVhD@"sdvu&8HK?C 5![w_ Eh'Ap0l8#jp; :$k0:F*Tr7O崺k_ݰ nDž'~_B*#~|"w4EBC/. |2vVQ'zxL5[R/.>˙-N4xmfxI0xd#QyL)NP*B|bjZt@6U`nNOe$Yb*ŊHA .G֚ҝ gtܗqIon}'c_.J#+νQii@KW؂dnp a K8 )ٙ!.X#0K8 c,; s Ŝ,IH,81 -h!$)u %߼Bj/ѕ'uY/թ[[0KIγt…=b7*WytqѺjKP3& JN-M$`pQQzxcz7idfbR]C"ߍp` Q3Վz$Z536Q"[F}z_1zN5}a3v#½ek@+Ϣ8g?2T 2tqpTi4In߫ڙTrDԊ Q|:Ì㡁 x$w-Zg2 ܫy >ݨА\pp0E -@z: Ŗ;uubN4҇_O磷!׃s" IU\_AeW,hb988ڸA ֭tcS*Jg 8Ώm\9K6wfyt Z;T$89S&R^z i9\n7$`j`IjҒ}@J)pZރf`I/}7_i?B?Nќ,(ycW_>>s2_w_A ]Nc}{VIqeSeKNXo1gK)PQc!XwYe8O<]7񦄲wI^D7ZWs3&A2$ڦ8+V]Ԕfu;?SXjBxrn9UZ౿zVՍvsrJ Jc~#j e&oGѳ2MU1͉Js!.}xY섁9qda)9y͵_MJ5(˹# #1/1n'spH!!D7ז2i9'0t`0\+ hC~_Gd2? ]s,^m+Mlnx,J؅j#d48vBV ՙ*\Cawa!#:v Q|=~3YHBxF#?5HuЉ#5Su Iٱ~5+Wt+2/T脍֯ٳDb 3ɾ}dć0<+(y??TF@zA//EN3N[>`_ OQbW]p5RUؿt g;2%|B /,ŭ%ԐVš%1lo߂]M7v8G낥j,&0~έ2A]%jdӢCq-x#V9u~'^k Zď)Qy6|?B Q1sܺ ު4Eߓ#\g[/c뛝le-8j)֝FgazϸtS“PAH8;41V%HEwJJ~2űJ٭Ƕ|xޗ#uÇFuÊ" -n)fU8Н0 9oX0h/[M:D-MODZ4d_)%')rdtH턡`xWwuvA4A`Ƭiͣ5}(s뾢ǞsYj!?WEE";MӜv~[׌H'UpV8F]/I5 v'_HNn(JxVE ԷO@&DlmNAlj>ށ(yK cq"Ul*:OdċZȝ9)\8Y\(rP閬ى)Ώ%z m{OeBX.L ;  J?֡Gt|P z͌n]htYܩx%!X| 2SJ|׽nne|E^ Z| |`VM"3پ0/6Tкgs-z>)sBT}?O77ʏ5:j3O\Efflxmv}@&5wB1 p2S$ss#"1 *.$#_32ZKr뉉E+*̍P QaitJFOEY .M(N۾jW9\{jk(~EiO<3uFP4ǂU ɞѢ#U` UI&`ILᢚhm4`.eڽ)ɠvv=|Ĩ4ƶi7 #0b󑡡,jG1Q1Cd3o]9VbAhx9fI0rC\fϑO09NH|C7ƃ#G|1>uł"USt3 hǔ/\fBI.>9~!~hz },d{3=- 9ӛWyi/ך2iMP. /ϦS/qB|@ծ lMИt #tl)UȜ12]Dz.ýe5iƬւoVRlq*{V'ìqfKMu$=?Mexѫ-dt11pͲKS~rOB_j(H>M\uԊ`^RITوC)ɪȀ$ k@u$:bTC3@``pze|0>8Otz׺ܲ3IÍIP "YdMqn pnMfd^D{ [4K{g*Դ2?7,jny]+(zRw%ޚ},qnG4VSNc_nN=1-LzRL}a-Tz(Zw)Gyv0^w=pRNp\Yak=r*vM2-xA>t߀)-ޚ!\q%%gq ZHt|nP7$C_-.c2A)W~]=) fj4˻rp9okv䯱6Kۣ3ErAL`'^&hAgM|4, KZlKOSS`s}t5jY46o%ś{Li咒6AVH\PYhT'ufxM?OF 'Jb>n]8@Qxou)<yMu1BGf2``M9 G<8FS!k@*6kA~4V0լk&?TplD;hFk&R7b!dj)@f 5WসeHMl6 (rmw H׫gaݍndvQ=}9RSwqW9[)߀$:3 ,;+VcWY_D 42Ƒ׹Sg# Hl. @xwzT9Cvm|EzE -ݢxpmߝ>mLm`\}E0B3hn^`j՜P#Qk~!\c~o JClA ,"0b5P&;?YǴLRZP): l .jͪ)mF4 &6R h!Ec*XX`^ DR}fX8,˛.+-0ڴ4 ~Pbyf̩N#A;+UYlb"u a+Xj&&,rb1J]s~W)*x46OAd䚆`oQ̶>ܽz4>e|2.P˒diFig AIi-I-WuD M:*MQ \6t3S]ұʢ:myA2Z1ǽlbB4AG&_FjZ&\5P[?c~$ `>Q!kˀ}ANl"33 ^ry;:2:|hZ^+fƒdHbc Of!6z˨H=/ CiFp?"6Ƌ3oHF͚Z( bjUZζ}n+"cBя7b`;D}RBI^9J`$p3:~N{=Uh󒓚)=ƫoMf~Py˴matĬD#m.w@*PZmnk![^GwE7)]O5 ǶS !-ۓ>Ö72!k;8_'Z IdãV܀!܆-}]!{#F-; G#^ _NG NZgtS`ƙdo~/JG(K#<)E\fugFDO:B֜t^: ՝~W,Q?iGL(&/d_10=]V o(J/q>6+™.4 ܺ7#E`߷`"˟X6_SUB͌Q,'i<^U[ gx5l 5k%#.''ӡPySWfW,%P=!4Csx3 1*+P]z'd< 4;^x>/X0 jZ\'YB"ѓ7B^&A+건epUd4 &/\ WY6Wْ[%A/tR;ƣV8ZA9:%bT/ t{L[{yxL%N!I?}ՎV` ndY >2 oߑUMIas"YYr/=zǠaV.E)]vXگ΀`SKG'QkrWݡ,?t69!8%'O|0)2]iEkd yʀ0uFIpG V !:Vy"2CN ؿ۬.vWՐ/WXgB'x⊪_¿ɤ)mzR#S_Px=ͼIo|ڞ߀`aO⳷/V݂DV}wxgW7J.o)h">(ၮfHԔ;f4PYA$$[e $P;n" e=gaHp5y>҆bG1wя'U) e`\0v/iɒmq o6tSy8:&.> HjӪe *tck/K>*ZI'mo}5VHy*s'N ~DԤGmiWE'd:μ=wO)BcCiE@1ãٽo[0p  ,qjTit.MD'rNݣ?' 9S>Z*!}IM>FDG}r\^!wȎR9ˁgUj0愩qQ'(!yqNזJ?" 4e>J/Hw֠Sܾ)g#3{d>aأybHmq9F].F_BxA[ɭ,V~>V0T"rv"/EO 4瓍COeLca0RYU^*ՙ_7ڸTF4B. mXlL Mfq8\Bqe ׿;~$3-:M8yl Kɿ)54~B5ẀyN2cj$E'ٽTY ,x 3>AĉD1tt`D¦ʵQW昇d#-΋0B?? <,B@01%B&gM#Mu*6C{y2{kP>Z?;R*ܤqs\^Zŭ"oC=,G3UO^+1]M ̼wQ/7eLEcQoOԁ P=iBl m^w'+6cO?Zq)$J,A}*Z5|G!AɭLSb5a1b>h4qez]iލe#bo_;.u(H+d"vHW[񩙿HwSݐT^k.ʴo!rcݔ v(\#Fv;8AxE#{}蛲E%Ŗ2b'h7B'kv;e-ґs=J=Hi瓫հ3މaceyF˶ ~*Y 8w etWqN_0pX9:<XFG=AczSN敝OjF Y1/{=7 (IȀ@I*iST}K3sN y+8'8Q/wxo=mAazGQv'+W*I?z]A?H+dU*A!l\gK֡Va\k" q-ћ7}3!bj0qt9;@i,-j4_a=3H[ɾj>VR%r#lޒ +yY?xP*[V B FIec-n i2rYf IĆw-#B P!VaIu"/;7H#*21!{< Rl D3WóV? ]5wSѤi@+{#`j-?$O\[gĽWpWY_kh Z [[*"[PU>f&nc/Y!`qyEOҭlpkPؠoR;+e=]K-ĵ5L ž%|igWoz]5K0G$a)o?<S_fm 4)9خrMdtT*G>7\ “`25#KTq:rP~[hAIAt@ S̅$[=?%v >hg OPB= W%yG4WH[̂=l^T lpRR:b;Mh\3Jo4 0#Ê/rMZ#MǿayoTz{|ǵ;а0huJ>זzMΐ qQ$f%|K ;$s;SK>cO. FtPM _eepFtSaד.Yyʝs*j eevZ>PpDN=o~=t,6 .fpE<k}YAyϰ%[ 2#8{%ĕFCj}g˱ϭDf:q` 8P㊕3u ڽ>ǧjp ="r+6U  8gT# @x;RyU+,^pz I'v'f8,=%(+2 ZicB=ov@G.rȺi܊K3V4"ew;bh?3.e$?-:Mrl}0U@!Fw.mIk,IAhNK 5'=9Ů3bXijs˪xo`{gDbRp t9[! ȿv2g۳] )7ko($[epѲbf>,M+:aqs>0Orvsml^V)õQ/+ C:MM䛽&Z+PSŽȿ vs+lYqT!茾_hw$Kv6M~PSZ$kt_(T1sN1 ZY BRruc8ҋM]iS-pW|8#pFŽaz< Iut0'EAe QhE7Vu͜(Z>5K"{M͞,%!:ݺOCY[j Y F yC.{asO XpQka 媽-ƻ?3G&:(q׶<_Q1)W#\C3wo$ |Ɨ v DE|ƹ'y}I+˳\m AfS%nwN=5F%C ǣM.4,Z$ .)@ Cɻ ݑo+!WޞԽb F,bkW>֑_lxlvϻ?5Zυ=~g ,Dea%W6A tHX\wnL3/Bpڣ[vX|./j`Uh8b=lz xʌ&z1'Â\y%>5h# i!tA^ (-i͉m;{J.y>ii 1w-ၧ)Z Ǒ{NbPdr"vZeT6 6JLzP>BgģѼ-G]$.36.E)bTC/.եq"В{hΣۚ/o<o.{89W%?|ӭ;On!{,>,CA"8 =Cv&G 4!@]r]1)(XU0H%&W@PeGQbHEKcvǚ!YJVYFYƀW9z 6c C *4Sc\Ex:ȲŤ .܃(R`@9=5LWPRxUobS7H=?hdX[s GT;r|`D`S@]|Z՗e?\ ݫNy(zi[B~KܛS)] e0hf 1I)@-}(x*s߄]df"Z g*x+*wFѥ:^K3)4n{vzkH7~$1uL}AҊJX(q%WahӷzZMנ.콤™*B?,sJVͻ5{n_ X~x)K[ؕxJe@B о|Ѫ+$&A2q?kUUMLۮa[2w*q'xTECB##?P߰cQ{O N+3)>{ѥDrBCz}-,쒭ˈ3Ѯ (BvQ !ݽ+?.xmD}$BHpGJO <~s2JT4L,Q{[I1=ev6u[٨ n3IZCl{E~t'$C;Ԡ/ dۀyjd,";(8u1'hjTɯJc ,a2VZ[VG sY m=9G(Vكpg:bgOϠ8s!vO1$@Hsy[V+9scRǒ{sۢ¬}M3 J?S/=Qdv5[dc#tonYvB} |vmrS5-M*iMC|_ A?Nv\uu1YӇtJ3FU;%PFhΤ1d($y] Nǀ0cЍ.fotx8{Mnw|4%it<ܠ(0M ګ =?O#Z?-En>6sX%hQ6 hex{a(;瞛دyT3Ӛو (zE]IYCH$h Fm3L /YpᨣA߁; (Q|i|`Ą> #Eٟ37E#QLY1^O? ,A@pU,sv,MN& Be uhҤc9 ڭ':u4h^fB[+tTQ[cS\o#v/+ =%qiD7oW:wJ(PiK ef1hz;BRNJ9i?R)*LMĆ\z{F qᮮc|%r D39v3ZW8PI͏HN-Y,{DlNט,[ȷ>tW!6(IuP=|xhP>NW\z ?<6Vϭ/[;]fmz퇂Z }F|Jh":M)o,U7tO J.Eus^~2Q) ?+ų$5~ 3 uX)`Ȩ{Y8-b8nλ&z+a+ \IxvC˙R?dg'Ef5,t?$p{51 l| NHmM8BU*칢ވlБ&π)ھ(; @E'%y涔i^QLqKrj=d=0]}g'OC8dMXcj۟8('24pz&!pTK9䑰o۵c ibZ:eb5=%0?xfm`(Sj2No>r"ly*YqzNd7iT8}PEѬe { kTx^ _9*?:cX42cHD"?ܪ UUrO;yWiMI7vߪ̨k2~;n\,<9&\!H;;` ޥ7z9{phr 6Y&=?1C'- F TQ.謽D qWrs@{FƉxB=6 !SZH(t/T?=Gмz~!bth%Yl.Ji,9ꔙ21oImN'߸*BMNo R]=kbx0fq9B|̟i0m!#pf«]`@J&7*zw?G޾&Ny5b;[>yv7e E:{6O07^ؾ [V{P$/@gp"ZxHTNAH0^uϞ_˳e1)~)&@~?ז񯺽14c%5҇MZ((pb(=;(:v# w z2I3o{_״܃U٘Q2a@ڧ'/hʤgwP\tZY35~=a8b0?;Hބ=~0 #e6.XRlKBV;} 9qQ?*J'>ɡepunV2lXF4a'mOAC{ A{JݶS ~β9$V *ek\EDM#FuBrTܱRg)0msnϺ}"DJ`SPZMy;l^ևƯP)$s*Ό!bيlOо%;[ e /SOZt -"|:^!^("@]\{*vxN@:C,+l =Cd2C_֭*;FrbZ Ol,2;m>zsp,e' 5 NN3RES`mHU}U5XiipD&"`QVA$*4wr֦k71p&jAu#+${^whMm{@F–^t> S<@j!@'tG~a֌w|yjU{dG$uPU vɌ@S+ViEM_*Pj!~Y1RrݚN ̀!`J>=S |hH,0ǥS3<t=sl[3yxczYww\ǹ0?wrr Vɗ夋}%mſ~ pK;R lYO02C_* 1? 6q'o"j8V\FM "i4&_ PQ@_.+7w/֜a%%by3c&\P"l|fCq㉽.5o '. `M+P@~c?`ZER^Ucy¯d(oʙvE3M2rCҩ>O.FZ0 (QHJK5=H ]X RRQ BA߾TMW`_=k4Ywy1^,x'`rCcG=MZe1js΄; i*<0˒S-{E!Gk$}+9ՠ7 4eɃ}JɍjKV݇ljC]`G.H 漪օ̙h%5-RVp6MFAeE(zz "H;k\N؆_"PppEs9lk7x! Ya]S}Sqw%T_mVȥ ӎl P<)浪wnoHe,- ]s1(58]pZwa(@bjFY#)tsˮWd..6ƍ+wzCr|+9pڌQq^ fE2Eub1.d fSK=6(EФ77l_8J?V+`SO) fd6"5ٵHxD &ӣ6{ʵ ĺ:?$חec䉌ɶPC}E}9$1@G@Cc،ǡ!-5'Oע%,@.U2\}6W57wNl%6,Xg( kgVҧ@-0 iGQ|:1fF)ҝi|H:~pj堨]uI&B$mNIPGt!:@^עN8m[CYLa ꆞQ0Wbs82-^C#zXaIQiIUOݾu,-0w,sZXu2@n.u\J~ks.7 <ㆳKg52ږӵH҈M]?FW=R~#߰s3_•%dQwt̆ODZ!1> w9_9ة5DEYrǔ\gXh3+(C?H*wxmF̝98֥y&9dr1*T&<쀳ն Oy`8oigzQ;f䐽kh6m |4QMohR*#Ӱ/R7~!*(AD Ƭm̦]\ t6dc)0#jɴ_ 4̇Q<.JDd$Y7,kiX7.Ò((rkPiY;9Z!WD2SKH`zub8k>5ge4sMxJ}%%SOW[ w+r?M3>03NG5ܴWd[ <%Y )uY F6XaR pANZ&7[֠B 5AF.G"Qvfk-I|ԙWCr˼K̻DGkr (0]ޠM@P}*yqlGD@g]|%M3CYu}"$Qص(D9GCTlEk ^_XgӶm a]Mwkp  oS!Eg o*bR)X!60 h_[S7$f|yO* v_KڍvRH'T!oG&k1 V')H@[,E.%apaǼ%M ϒrtMZ(ZjU AB7 + C(# wK* db}Kuo(;]Ԙ)ӣX]3qqT/t)vHVa0N@!(Cf\߂cAݨ1q==Uf޵9='YɉiQ`=v*ԟMEcN'|>|! /G + G߾ѩ&a^|v!y;y W*۝Sh{ 궮  AZaf2,mrDb{li2Hn,\s`z'/%\C8`iB^]S|04p2J(MoQ ա YU@JdiAW{!P',[P| &P<Rw=rMr)y~0”Җnp6@g{Mhn|lK&Q&]t9LsD^ܔhnrGXkƐ8~ј9Y^|@W>s^Mbq !%ꜩ~߭2J$]ه.*eŹn"0״ v~Wi1޾JY74|y-$WRV IUq1:DF0,#qYeJwÑٸZNNkn*I?#Z5*rFEb d`H&ڢfW_׏#uKZףmH>pcJWOi!zSQ%۔c~wnQ)b؝|"G }swLOHq'{8?unم2j7a a_iggޜi 8X!B/O L>oV}:@vf,ZN^\o*<7brNb@hA^ u 3]> `މh%yo@?wU0cY8X1Xp(N LRwwsOYS/F6-B5:2pl rh`2O4(?|&E5?n{8-٠(fF7 LK1/0. pd"8YDްx{1agÖWRX \Moo}>-`6'kN[J",LsJ#0kY)AeFZwl$csis0]Th*Y:0}lO6 cRRT~5f Q$RۜexeL,({_3[{_V5MurU5fy+13z`ߑځ?5{S -aQ{IӴG}qYIq$9F󽞕+-T #.>)Oؘ1cm'N_vLڛ*A{Ah:0ڈwCVDF" & r S!U7F/Su}vב|{&wic6kTtC]Ʋ`iV%$3% TZB(Wʀ&Y5$ l>\"(Sh,) }-rգXe FfUPë'l9_샬88vQx+L?r1V&TY̆}Dj G2rf#]Csg`0@q UVc@;!+*N쪯lqjywqY[f{ IR7 / ~Kӂ06tboiQI)ʥ^ \VއvpƇIJ5$g4nUҢ_Bra=Je,PG.;uPv>;w<+N(C -CvL頪ZL0>|̮Λ3NX %en.m9!;-A;j?vZ[8 +2SQ‘hAi9 c&A3XZy3lS )4-c|~ƽ)mI# 'l&_ bh:ܧk(T p2NVe3ȓi]_ Ta4\jV'2`WttqMoeP~mzZ:hfOdH9R*J t'{跨!h>C/3mzw=p)hn-6]n&fo_Aubˊ6X54tYpo:.-}+"?̟Z'$}-BORUggα#+(voD87py3/5HB BGVYRԑ 11~n#<ܝrD}dZ {Ki!8m_h%h,l=^.U6+9J/ DuBpmYڥ D 9N02xPF'EDk6n^"!f" aV(7N卷 )YC } 룶=_O[OgAFRg>Ƞ g:.dNc($N@`y > +ԑaxA+(ו p+G)xK*N{OtFEMЀ/I!>dyT.I+wV2uH ~G1l"TNIǦTjv)Z'h")I>T07U~:>ʬt/9'@$:eGV72ջt&cŁ=Wpz+RƢ!]uNi(v~>nڜ' 3_\h/!O5&FkƟg#&_ ( DW"^[x~\RlʳDzG:j:5%+у>f1 " gy쥆\}z@)~.tL+;/ڦ Ȟ68 Bvpl2M"t|+71U&Ry^t5 A= &d-NhcCqY dK_CB˱+8Q嶵ߵلP3]v,ђ%)i&/di*lZ#,n#b̖x*6oN()H_8cp!Ky,yW+p!n[Їy^noTRօrX5!iv:妫ZZ }FvEaIU39[+_aPw5⸵Śu_JHi48 On\/Z:O׀,C_{,3'[dvf,ܼ~ ;[#418jޙ%!*u] Ů2%ǁ݋-ε[|XS M!`.RT^ 9rMNy ݾ"8P')nb6-~5Et|ҋH'լ[7mm4ƟTZE\U'c&KSGı0Huv~:Og ܓ:\vK.zt> 4c$Uuylգg4'K҈`sk`iv2KV_Ga )=':+3%|)j3>,ڵt0qk8D^ɥyZ~6Jg#6ANwoW$Pi\mY40*ߦPv4|3f8P#z7=w2jфUpImџЙ_9~y쁷JyvUׯDߙjǼUeNF q P$Jb{h@ohM|+xxEmYicƆ%N$W4:l)6쓢7 DG=v8~S~w#'P5`_?[t*1W6B~@2]1`fÍAK}em$Z&)'S35vRK `]2x_l^{#އa7%⸔AEn2FTxawi=?Sx%R' S tlsJeq,_oL Az9uYdlkO c*iSKo}S6cp5z06Zљ wy(184w<5nJ1S(⃹e4Iefl^J/>BHG)G^o)R]N6mxt7Uf3jБ .J"qa:we/Rd.Jh AڳiM߯2┵%7>k 5 Kk=Z]޲@J0 'NwZKNMŷg(k\c-jK rÈQ`& mDŽ3<ΝW ;a7wJ.s1SX+I cU:wB!%% lU^Tٶ=&^.z(r {b` {Styk%wHg $.O1T邧-oƯ ƻ3Qb:>HT(EB_Qgmv#5Ckx;R5߄ ;>_J 'twV/J!Xd;A14iϙK ϵ0 ! Q魍wxpF:{l48Xv͘PFT+đ,NƓ.lJB(X?$⍅o&/ rdg@T8[Ξ[dgv4b TN죕?{sQZv)Ӗ9B:PՙfŠX4LΪLS0HҲuj_wmWb҇";mC,k#^XY–K(r0[hHKA 4<5U=#9Ĝo^υyv2ZmPzHYF CCɽ KE#߲xBXSom0T $?")Haɍ2_XկrWK _X?5oaW='iCBK`12кp3.HRQ'~  1!I@7OdAk XͲױO88B5H[ŷ> : 6 B(N*GшG9~P6{\unaC@=GQs&BYߩ0+%*4TvD9֩f1Ð(MmN\'=Z؝Hp+g]K}FiE+ L־g+ cThE*CqՍ9K ۪Hv9 HeB܆Ńk?ov#Gg˲hi5"fnF"L+¤ :mEo."r ?Zb_mq8E);Fg=ةwagf#-m )Nc$2T%jq TYB!uIOȪR  +3 89r N㘛1')~y%ir[O+kfz:ښ+K(BDV|l~O S&:٬4~[&QSO$(r0*J`m*Ɗf2GO&?>g wѥ!a:3J15Ɨ+`+!7gio]fx(h.k Cd"ey\`> qîcpO8}y\b {b3v Aǫ!ʀ.Ne6O\ܣTMGX;C=S`zv WKۺ`λؑ;-Lt̿5TϚ(@`aR 3 L nŷAA>};;4+!à4~rjn 6PU^$5kGC(fGe1,Z^Ff՝)zʏ|[͖XytE!i}ZNŌ$8r*,R }t1|Tdavj}9BkK5K)^H AI\,o JgJ vej='D2-Η%F5Q\ Hr#nٮd ,"$ЗE.e-GCgj]"]YA;3J*;1!CWSg\[?ͽ]1\'Ǣ 1A0[w~]F'g%|p.G:B!u GOpl-owrQ GyF(!;;kKısxL:8&U-%r &[9WCCOY E=&L{Zn#a{|75A2 8U3ȆDܠ #:7GX2ý`[7GMWجSuv}ss)VL YҭNQKPE ">̩p9eFW;U9 3Gx&2dcn5wz'4 M"h'Q.b^ΏI$;5\9cB Luo_s+9E`+l0w| Kvʗ]deDM}1fu%AoI|6%.Ah8uK4.F~S$?bZ69X|wzIua' (>0RL:=ÞkUI[{6@ݲ@ ^V݂E/Yu|os.Jg*jI6o"'sKrΠ<'5HMW$ԦR0mF=AP̥str4TM^}N6(DN~NEFN͜W `>|ϵ} G=ثV ,p2Su?JS.mTis ̠óyuaה!Pm\CT2A 8'.nbdkewޣ1х ڔ)lo[ νc_S&^[տ\ĹƋ1Tԩ2uA~ipO=k̺:ZvK 0(Rg!GV_PExP،.4t$܄)»Bw!*ߒT:{MUC(^1lrq3yJ+PL[Ս'|&bmhY+(՗q#p%1gS~7t#s4D韝1b\c%n>v=/ E_>e7C~){ƾ ]#c+4f \Ԁ|bsF}4Bmn0bL&Ɩś%(ZNE#Kmx;F٤tL3TbtE@Jg 6QՖ| ==6Fc+G8}Sgv>ӆFjS`d+V'7,6]Qil(ccl%U`mn3_ƥ$E%lUU$b@Q+ll?0>=xqZ87ހ{z:]_ԷZD.]q,QK 8Wo[΅O$pW?ʥ:%Njca-,}i.Mvdn ֡$Ol 0@`욧 .l4)Xw&٭*ӺIC1xHM AvȇCsA8T!IHϐF|~_9YU8Ud wy՟$YDi֘ YsXگl}5(d٬-x%6ܡ :֞-N^ޗ2{Mȓx-=j&tA/=X.Dr^/^"G3z )!ʤQg#oļr!S%f³"*ՍryJ iS?i4Y80 Fu'_*Z,ԏ]P9 ap,+'H \ϵ$Pg/OCM򱠁_Eǭ[gߜ nvH~m5"2yls#ē}L^wN~ۇ2pjjBXFSE(b A[s?%V 3O0yT?YFկjk0a2Yy0 ,"4٩H(jdS fp~3Zkאe>"k CȶRt\ i@xd![Lϛqg:L3@Lɞ'œ2ݡ ~>+n'|?p+15iT/Vw)a3o/a;˟5o;g+񪯭k0h$t,WoɮF64_g@%H 9jʛ[m 6a4*_\N{jyt_HuKY\(, L' ʔ &Ƨ/ b1.3D=UH.%@0GBFJ/S"̮H@ٮ%)|zgI-d^"*r|H`.|;LA&}ax Buy߸_V e4bƢrB}l ki)fCLz7fQ1o^{HrEgf9EͣNZ:gx pJ٤CnR?A'} v,Z-"1CQJԮ<+`II竹CXM\kMhYJz[%SJۑu`zonXkEZȽ{u."mÒO8yH|9z*|Ҧ$36 j߅ӽ"4xnʑ CSL [Lg0;h3Oڐ,,ZM M^uoWx@Z鳍ˀ"x׵&OR4up4+jҤe8VکV?kvތ^ (ZUÃ# H:`Hl^(X %5.u>fy m qWYɡ0 ^"~o6hmB,r[>;xCJzOgfFk0ځYႧGt%NvArퟲҝMQ>I/u{9a-gms;+UWkk~pٰ8+6LT \ӰspP /R]* =xߐr/˧S?_Ønhf^ )|Ct:>/%\WT7Kh k)I<:wv&2_751o~)21Қ߱[4u TL*>`1LD KW T . ي}r̨Cf8tHdvo 3u!26_;~- /4D>XNH2D6E׃--X@YVJp@xB|"^^$B6<^3,75Y#Qkq˃@;/0OQAv'ϘA!`vtY Fq҉FXwXWri˘n(:UYv5?{+"|eR u;f\}Hv{PWU bсI*U1ԀiDme{)6N[eyI N[IW9EAߢ(鵊K3gPۢr mGy>÷;4TAXx0y3\ӕ4GZWj! uMYj2Sa׌CX( T!H LkHxDqFc8y> :K+N29w[blqKBbSzl{^[`h#AyeG#C~$_ c_ʍ>"O9]'Ѥ߫Ժ4$aڽk6}owݛeSS5F)!"/}%H]IFq+x/1RGH&;,x" e=B۲x C_yX=ydz~pÓ I:!`lAt%w k93ҺQ}D鿨CY3)zw =Nj2fKhUcWImca"J0\YN,<fsqYe] Pb~鉧qJa88%X^}PM$o䟤$~^7ݭM(t@?Sg_2uwJ#KSzM à M@`scpoDOʨnu5>6[Sm$A^oϷ? ,ˏ&v(QD>z?RU,Js!SWy61۫?>Ѧyh;t`B/PϪ8~`nf6{윺lL!NB3x;]]+$V < ;%1bl*pƮpK*IThJ^ jai,/lA|4J_+AFFw&F8Q;sFX$㍷ĕx",?!MLΫ8EO5BQK+ h1:r =S:{HI/Jg3:uȎ_.P]ȣ՜ K' BFBw n жot;[F>ZP[Pd&btҟѥoZ͑N_EF‰#|xiほ/ R\1 ~cxmmJCn e?Z z[y1Oy+p8,#6_7!3{=|s!x~g[C\j0{MV5'SVQK:{7Xo$Mn$yƄ7բ 幩7(!N*~ j4[6so $Ǽҋ,8DeNh$j$yͰ߼\ "Zv  f`r?jĿ˩#~0g;8{6ā@rϤ7I+:N;% T6p2⨹M4qEc˚"()n#gIȻlPuN50n!0\tY eEY`v_&=hJ+Zc_H2,ʇr$@;~\5ˤUm oGX4֙mI?5\|P]v]P7jdВS$,/W(}Ԩq$d̼:F2?J[G?RcLP}`^mid2H]zJ5AՋ͐#sXxՍ ZN=)(X/ՐC0yLoO/޲/ =_i:IІ/Q ӍWQ-O D-%ߎ=2Hבn #;сӒwU{zǏLk L<w1W;iyG} NRc *aky[f}sO*.9}U|(*JExc{?@Bs Bv6r'3ϸO)/PG#qElx!w+MMￅ"}~:QtsJȴ G;Cg@>P*_[d:<[7z ^{Yޚn/.B0nd6ԡp'emx;w茇Hq :!E'mmXl;>t8+y*+'9SaTHN/,tW5h#3,f+@Ϝnj|$fk(F]_zy{5dzF @q+1swc2۷PʁT_Y*X]- k+liaQ.9sFa o*d#L&A@i;0r^pQF؅_A6Ȏ\[ 'jr^e XlrGܬk{ <6}'c6 &敭p1v+?ibeґ?/zSҌ`vꞰ Ki_mYŴAsجClZM/d/sbs|z߳dbHgro,s뮑uR;zB%Pb+>it`1DŽ4ǻCaVj%ߢ*쳅*#^nVˁڇr--4Z椒׌]eQF =yַ;L+iNﻂ"޷/mT>2|k jVBk hqsFR`Ul[) sۂx(qX~X\}/óyK q]zI>9t6vD˙2HowD@y~w5;Val. D^1Z 0.v*\Aost y9UnBEqkk`inv #Wy9=5S zǟo=Ϲ|;, O gAl |O4+7{;@6vfg?e>4aC''0;QJUz实\)AIT)SDX+4-e12F)`88m񚂻J^D%(hzsZ*0ҏ(+PjU LoǠi B%Hv3{d<ाL1bRE{~SW9i2>8l;G[}PBkxF>jG+"Wq3"3W_vt}>>A/=)41ֈwV^/FQP>S6WI}<`jGi{'[r-$0W&j&cHZ8X})!zaliT VQƥB (\T|櫅Vi t5K=U@*Tzjnd<$~AfUc''г$(<)-y_f=&W~L 8@^{w!S2H潐; N%C r6=`.IzmڿO)pP,|~7219nCv]{`XƗ@׌ X }Ò'݌G@UF!~dzf*T.eU`45{>gF?B(NyNy(H;_Qayfw3y9lşoOؖ FBZl\ts3 ƭ#hJD#(>$,ˌx`'_#=lݩo^0!@Q#8;f >=]_Ŀ;c$Zʵ cE_i%*S,_mMNd&5FjKZ*m_1TƷfǰ1y$GoHfQ(nd}02D_}e[T[zϴ6ɛV292j 㥩YӮKVqeu!#Qg@e Yɠz'h*;3@'hh)x3EΒwZD&.0{^*[$Px8  ~QRMj@&p@T٢÷j1&_@MHfͪDڌ QzF 9W`~{{/ڋ4VYCm.Л(Y9R#NUНuW 皢 ,QnG4es# )Nǒ"^vKPF9BLr4W#DLZ7-y$I˛XCߚU%>rm\/] ].HH [ܺ[s g}̡?.֮t~5ͼUKM5$W0 ݺ qE#sfhy_ەMIڐ3ѬuL>5(=\}a]\8v>vqHA)h@q,HT,vNS#,iڤ޷'$ f'O\,g&@h\^]S\beAa^a>7(Q] 2h'Iݓ2k AQe;10H)<*YznCԉ27yߠ$7fto+LqFnâx)ĉ^g}r0F8&:^t=UU` _n'\s `샘_݃}'΅'e/&*N]|E ƿ;=9?cT?7D0,"Jrv7Y 7Fp0;Ī׈CQiI|I=̾W' *#KC-¨H\ˁp٭ܶ0B{,umNp.Xz-8tӌ2slqƤqѥdb7pBS br0Q g3k92| 2Znk"a{aD ІY(or\cZ {v"c%.8o&O1)!C+>ۊ"s]ܕ+4|5Ga =θP-xᐁ@@nj_;Va%U*B\s/M: dӒAMdabkw4 /TJM u~i@[z=YY4#}dM-LGޠx6]XӋy :+q?"Rqݖ.MNϸGg4Ƽ%aS_$ZOXA Fax}aSeB4肄e:ZYuJ)a xUX1`[MJMZOį0n]%B-jmߠAWg>ԶҎ! 9\2# N3YUu1ZGbmg/NBP4NkLi36ٔ]|sUd@Y>o8Y]_Am;HGЈvMeGHh`GuvDgC~2 p+NN(^M –1U܄$v[]͉lwy-{3ķ"c 䅥wܖe[ai`P8B>xs+&H F}50d4b foZ_mfv^BeL0ۥ,J;@$Fi|ቺ3n kzޢ\؜.3;@ ]zU~:z!BOD4z~hslMq3`>Ol`č-qPS=HӺK,5m[CHp;!:t2ȁx}/i5Wh@S$)jY}vsk -.WU^˹LapvC:Fz@Ĥ ((D~L^hB?k bz%v]e(QS#w Z9,1sNME~sɐBrw(,YCy"Ø|^$tQ*9 Ft}* ~"?GDM1#yehxiՐ75QX&ÂEſqfH|=M%?I *C!J5V[YL#0?[dW`+47>cXB;I6q;<>k.Pc&C;,m%سO9(4݂0=B!g6z! ´w -葀{?!3S(//qݦv?<,hl=3BLeD(Wjvk(JM6f;۫"Ɗʸp,lXqN le7/b&JEaL ~j a#B;(>X+E)p@oM~SjͤK2Q$!Y{4Svټ\SB*M{<zSEBeFB%I%Z¨4gF$vu/C O鬵oKؚK9Xsc6hPH6ZSE-1SfUh^ Y:N?TE ge.k*GdK LY }1arfLr?I~G>8MC5jw O^@L b%@Pj6Re1ԐZnZ}7G ަJۭ ^iMQ~E^ZłmvS3>Sg*CQøq@Ɛ _p#{5}E4Jz^ƠMkBU[dod{yZpyg2#zά;S ٛ2eBw9gP$ 2]V贫CR(n,drF׉_ttǡ#:2x34#cYl]'uz@ȾN;TR,^\5 Y{!_n1 Xqq$b ۙ=YW|Oz-XI1k|{@!D0,2=u$%Lga0b [F|rOmėKXJ ޓ [rFI9,6! np*~ yZi׃#5;ih= v~ĭ +cXaNs,pbӂ6dуY%~CHjgM:=/tSD: -$]V&誣Gxn3ZlցގS )_DOsM[6D O u2eGU$>rJ (Z=:h\Eӂ7&fZI~% (\  =osP탣+js-rJ6neRCXw3 :fªߘsq>u26wUT%Ku#2C02 ©Q'ۼw1h*fp̄'WqF] l